DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and pdlim1

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001017870.1 Gene:pdlim1 / 550568 ZFINID:ZDB-GENE-030131-5227 Length:322 Species:Danio rerio


Alignment Length:399 Identity:75/399 - (18%)
Similarity:117/399 - (29%) Gaps:174/399 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 EQNVGVQVGSP----AHGELLRGDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHRDNKIAY 123
            ||.:.:...:|    |..:|..||:|..|.......::|.:||...:..|:|:.|.:.|..    
Zfish    24 EQPLTISRVTPGSKAAQADLCMGDMILAIDGESTDGMTHLEAQNKIKACGDEMALSIDRSE---- 84

  Fly   124 TQGATQEAGPGSRSNSTLPPVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLPQTVFPQLNSSGG 188
                                                                             
Zfish    85 ----------------------------------------------------------------- 84

  Fly   189 YEVPSTVFSPKPTRDHQQDVDEEQAAIVNQPYRTTPLVLPGAKVKKDAPTTESYLRHYPNPAVRA 253
                |.::||..|.|.                :|.|..:..||.               |.....
Zfish    85 ----SKMWSPLVTEDG----------------KTNPYKMNLAKT---------------NTQEEK 114

  Fly   254 HPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQFNSPIGLYSNNNIE------DTIRSTVP 312
            |.|..::.|.|....|             :.||...|:|:|.||||:.||:      |.:::|. 
Zfish   115 HIGSAHNRSAMPFNSA-------------SPRVVTNQYNNPAGLYSSENIKNFNSAVDEVQTTA- 165

  Fly   313 FATSESNRLKDSPLHRPLPTKLNGYKKTVQYD----------------PRNSETYRAIQE--EGG 359
             .:||::|..|       |:|....|..:..|                ||.|.:::.:||  |.|
Zfish   166 -TSSEASRNSD-------PSKPGHTKAAIAADSEVYKMLQENQESNEPPRQSASFKVLQEILETG 222

  Fly   360 YSN--YGQSSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDE------------- 409
            .|.  .|..|.:..|..:...|..|.:|....|..|..|..    :|...|:             
Zfish   223 DSEKPSGFRSVKAPTTKIGASVGNPEKLSLCDKCGSGIVGM----IVKLRDKFRHPECYVCTDCG 283

  Fly   410 -NIRQSGSF 417
             |::|.|.|
Zfish   284 INLKQKGHF 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 13/50 (26%)
DUF4749 285..359 CDD:292558 27/97 (28%)
pdlim1NP_001017870.1 PDZ_signaling 2..80 CDD:238492 15/55 (27%)
DUF4749 133..223 CDD:292558 27/98 (28%)
LIM_CLP36 253..304 CDD:188832 9/44 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5287
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.180

Return to query results.
Submit another query.