DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and lhx8

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_012816489.1 Gene:lhx8 / 548653 XenbaseID:XB-GENE-494997 Length:385 Species:Xenopus tropicalis


Alignment Length:242 Identity:46/242 - (19%)
Similarity:73/242 - (30%) Gaps:77/242 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 KDAPTTESYLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGS------EADTGRVFHKQFN 292
            ||......|.|.|.....|.  |...|.:...:|....:.|....:      :..||..|..   
 Frog   149 KDIYCKLDYFRRYGTRCSRC--GRHIHATDWVRRAKGNVYHLACFACYSCKRQLSTGEEFAL--- 208

  Fly   293 SPIGLYSNNNIEDTIRSTVPF---------ATSESNR-------LKDSPLHRPLPTKLNGYKKT- 340
                      :|:.:...|.:         |....||       |.:..:::|.|.|......| 
 Frog   209 ----------VEEKVLCRVHYDCMLDNLKRAVENGNRVSVEGALLTEQDINQPKPAKRARTSFTA 263

  Fly   341 ----------VQYDPRNSETYRAIQEEGGYSN-----YGQS---------SP-QEVTIPVQTKVY 380
                      .|.:..:::|.:.:.|..|.|.     :.|:         || ...|.||.|  .
 Frog   264 DQLQVMQAQFAQDNNPDAQTLQKLSERTGLSRRVIQVWFQNCRARHKKHVSPNHSSTTPVTT--V 326

  Fly   381 QPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGA 427
            ||:||            .||.....|:...:.|.|.....::|.:.|
 Frog   327 QPSRL------------SPPMLEEMTYSAYVPQDGPMLTALHSYMDA 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492
DUF4749 285..359 CDD:292558 14/100 (14%)
lhx8XP_012816489.1 LIM1_Lhx7_Lhx8 103..158 CDD:188767 2/8 (25%)
LIM2_Lhx7_Lhx8 165..219 CDD:188769 10/68 (15%)
Homeobox 258..311 CDD:365835 7/52 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.