DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and pdlim5

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_012817118.2 Gene:pdlim5 / 548530 XenbaseID:XB-GENE-854114 Length:884 Species:Xenopus tropicalis


Alignment Length:396 Identity:79/396 - (19%)
Similarity:126/396 - (31%) Gaps:108/396 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SSASASFSRPAFWKVPGYELPTSYRPQPTPKPPLVPLPSPCRRRSSSGLKKRVHFADEQNVGVQV 70
            |:.|.|...||.|   |:.|.....         ..:|....|.|..|...:.|      :|:  
 Frog     2 SNYSVSLVGPAPW---GFRLQGGKD---------FNMPLTISRLSDGGKASQAH------IGI-- 46

  Fly    71 GSPAHGELLRGDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHRDNKIAYTQGATQEAGPGS 135
                      ||::..|.......::|.:||...:.....:.|.:.|       ..|..:|.|..
 Frog    47 ----------GDVVLTIDGISTDGMTHLEAQNKIKACTGSLNLTLQR-------ASAAPKANPNP 94

  Fly   136 RSNST----LPPVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLPQTVFPQLNSSGGYEVP--ST 194
            ....|    :.||     |...|:|..|..|:      :..:..|:. |....||....:|  |:
 Frog    95 PQTETPKEIIKPV-----PIASPTPVAPKVSN------VAYNKAPKP-FGSATSSKPASIPSASS 147

  Fly   195 VFSPKPTRDHQQDVDEEQA----AIVNQPYRTTPLVLPGAKVKKDAPTTESYLRHYP-----NPA 250
            .|:|.......|...:..|    |.|..|..:.|.:...:|.     |.|.   |.|     .||
 Frog   148 AFTPASASLSIQSSPQPSALSLLAQVGPPPNSAPGLHANSKT-----TIEG---HLPALSATKPA 204

  Fly   251 V---RAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRV-----FHKQFNSPIGLYSNNNIEDT- 306
            |   |....:....::....||..      |:|...|:.     .|:....|.......:|.|| 
 Frog   205 VNVPRQPASYSQTANLYDNEVAQD------GAEVRRGQKENQGDKHQNGKIPPKRPPRKHIVDTY 263

  Fly   307 --IRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTVQYDPR----NSETYRAIQEEGGYSNYGQ 365
              |..|..::.:...||.|:               |..:.||    .|.::|.:.:..|..:..:
 Frog   264 TDIYHTSAYSDASKKRLIDN---------------TEDWHPRTGTTQSRSFRILAQMTGTEHMSE 313

  Fly   366 SSPQEV 371
            ..|:.|
 Frog   314 PEPENV 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 7/46 (15%)
DUF4749 285..359 CDD:292558 15/85 (18%)
pdlim5XP_012817118.2 PDZ 10..83 CDD:214570 18/102 (18%)
PRK14951 <80..216 CDD:237865 35/162 (22%)
DUF4749 212..320 CDD:406377 23/129 (18%)
LIM1_ENH 708..759 CDD:188837
LIM2_Enigma_like 767..818 CDD:188748
LIM3_ENH 826..880 CDD:188843
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I5190
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.180

Return to query results.
Submit another query.