DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and Pdlim1

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_059061.1 Gene:Pdlim1 / 54133 RGDID:68324 Length:327 Species:Rattus norvegicus


Alignment Length:400 Identity:75/400 - (18%)
Similarity:123/400 - (30%) Gaps:172/400 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 EQNVGVQVGSP----AHGELLRGDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHRDNKIAY 123
            ||.:.:...:|    |...|..||:|:.|...|...::|.:||...:|..:.:.|.|.|..:..:
  Rat    25 EQPLAISRVTPGSKAAIANLCIGDLITAIDGEDTSSMTHLEAQNKIKGCVDNMTLTVSRSEQKIW 89

  Fly   124 TQGATQEAGPGSRSNSTLPPVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLPQTVFPQLNSSGG 188
            :...|:|   |.|                  .|:           ::.:.:.||.|. .:.|:  
  Rat    90 SPLVTEE---GKR------------------HPY-----------KMNLASEPQEVL-HIGSA-- 119

  Fly   189 YEVPSTVFSPKPTRDHQQDVDEEQAAIVNQPYRTTPLVLPGAKVKKDAPTTESYLRHYPNPAVRA 253
                           |.:..         .|:..:|           ||.|              
  Rat   120 ---------------HNRSA---------MPFTASP-----------APGT-------------- 135

  Fly   254 HPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQFNSPIGLYSNNNIEDTIRSTVPFATSES 318
                                           ||...|:|||.||||:.||.: ..:.|...||.|
  Rat   136 -------------------------------RVITNQYNSPTGLYSSENISN-FNNAVESKTSAS 168

  Fly   319 NRLKDS-PLHRPLPTKLNGYKKTVQYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQ- 381
            ....:| |..:|.|:  .|.     ...:.||.|:.:||:   ....:...|..:..|..::.: 
  Rat   169 GEEANSRPSAQPHPS--GGL-----IIDKESEVYKMLQEK---QELNEPPKQSTSFLVLQEILES 223

  Fly   382 -----PNRLVPGKKPVSAPVSRPPYNVVNT-------------------------HDE------- 409
                 ||: ..|.:.|.|||::...:|.|.                         |.|       
  Rat   224 DGKGDPNK-PSGFRSVKAPVTKVAASVGNAQKLPICDKCGTGIVGVFVKLRDHHPHPECYVCTDC 287

  Fly   410 --NIRQSGSF 417
              |::|.|.|
  Rat   288 GINLKQKGHF 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 13/50 (26%)
DUF4749 285..359 CDD:292558 26/74 (35%)
Pdlim1NP_059061.1 PDZ_signaling 5..81 CDD:238492 15/55 (27%)
DUF4749 136..228 CDD:292558 28/102 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..186 8/26 (31%)
LIM_CLP36 258..309 CDD:188832 5/39 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5207
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.150

Return to query results.
Submit another query.