DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Zasp66 and PITX1

DIOPT Version :9

Sequence 1:	NP_729395.2	Gene:	Zasp66 / 38988	FlyBaseID:	FBgn0035917	Length:	430	Species:	Drosophila melanogaster
Sequence 2:	NP_002644.4	Gene:	PITX1 / 5307	HGNCID:	9004	Length:	314	Species:	Homo sapiens

Alignment Length:	119	Identity:	27/119 - (22%)
Similarity:	38/119 - (31%)	Gaps:	28/119 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly   122 AYTQGATQEAGP-GSRSNSTLPPVTPDLMPH-RGPSPFLPGPSHFERALQLPVDTLPQTVFPQL- 183
            |:..|.:.|..| |.|     ||..|   || .||:..|..|:.....|:........|..|:.
Human     3 AFKGGMSLERLPEGLR-----PPPPP---PHDMGPAFHLARPADPREPLENSASESSDTELPEKE 59

  Fly   184 ---------------NSSGGYEVPSTVFSPKPTRDH--QQDVDEEQAAIVNQPY 220
                           ...||.:.|:.....:..|.|  .|.:.|.:|......|
Human    60 RGGEPKGPEDSGAGGTGCGGADDPAKKKKQRRQRTHFTSQQLQELEATFQRNRY 113

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Zasp66	NP_729395.2	PDZ_signaling	<68..115	CDD:238492
Zasp66	NP_729395.2	DUF4749	285..359	CDD:292558
PITX1	NP_002644.4	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..103		24/107 (22%)
		COG5576	36..>146	CDD:227863	13/78 (17%)
		Homeobox	93..146	CDD:395001	6/21 (29%)
		Interaction with PIT-1. /evidence=ECO:0000250	147..279
		OAR	276..293	CDD:397759
		OAR. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00138	280..293
		Nuclear localization signal. /evidence=ECO:0000255	286..290
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R6207
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.030