DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and PAX6

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001355839.1 Gene:PAX6 / 5080 HGNCID:8620 Length:503 Species:Homo sapiens


Alignment Length:459 Identity:89/459 - (19%)
Similarity:152/459 - (33%) Gaps:148/459 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PSPCRRRSSSGLKKRVHFADEQNVGVQVGSPAHGELLRGDIISKIGEYDARDLSHADAQQLFRGA 107
            |||   .|.|.:....|....|..||.|    :|..|......||.|     |:|:.|:..    
Human    73 PSP---GSDSHVCTGGHSGVNQLGGVFV----NGRPLPDSTRQKIVE-----LAHSGARPC---- 121

  Fly   108 GNEIRLVVHRDNK-IAYTQGATQEAGP-------GSRSNSTLPPVTPDLMPHRGPSPFLPGPSHF 164
              :|..::...|. ::...|...|.|.       ||:.....|.|...:..::...|.:......
Human   122 --DISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIR 184

  Fly   165 ERALQLPV---DTLPQ------------TVFPQLNSSGGYE------------------VPSTVF 196
            :|.|...|   |.:|.            :...|:.:.|.|:                  .|.|..
Human   185 DRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQMGADGMYDKLRMLNGQTGSWGTRPGWYPGTSV 249

  Fly   197 SPKPTRD-----------------HQQDVDEEQAAI----VNQPYRTTPLVLPGAKVKKDAPTTE 240
            ..:||:|                 :.:|.||.|..:    ..|..||:     ..:.:.:|...|
Human   250 PGQPTQDGCQQQEGGGENTNSISSNGEDSDEAQMRLQLKRKLQRNRTS-----FTQEQIEALEKE 309

  Fly   241 SYLRHYPN-------------PAVRAHPGHD-------YHDSIMKQR--VADTMLHKVVGSEADT 283
            ....|||:             |..|......       ..:.:..||  .::|..|..:.|...|
Human   310 FERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRRQASNTPSHIPISSSFST 374

  Fly   284 GRVFH--KQFNSPIGLYSNNNI----EDTIRST------VPFATSESNRLKDSPLHRPLPTKLNG 336
            . |:.  .|..:|:..:::.::    :..:.:|      :|..|..:|    .|:..|:|::.:.
Human   375 S-VYQPIPQPTTPVSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANN----LPMQPPVPSQTSS 434

  Fly   337 Y------------KKTVQYDPRNSETYRAIQEEG--GYSNYGQSSPQEVTIPVQTKVYQPNRLVP 387
            |            :....|.|.:.:|:...|..|  |.::.|..|| .|::|||         ||
Human   435 YSCMLPTSPSVNGRSYDTYTPPHMQTHMNSQPMGTSGTTSTGLISP-GVSVPVQ---------VP 489

  Fly   388 GKKP 391
            |.:|
Human   490 GSEP 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 11/46 (24%)
DUF4749 285..359 CDD:292558 16/99 (16%)
PAX6NP_001355839.1 PAX 85..209 CDD:128645 28/138 (20%)
Homeobox 295..348 CDD:395001 9/57 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.