DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and repo

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster


Alignment Length:423 Identity:87/423 - (20%)
Similarity:134/423 - (31%) Gaps:107/423 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 TPKPPLVPLPSP----CRRRSSSGLKKRVHFADEQNVGVQVGSPAHGELLRGDIISKIGEYDARD 94
            |..||    ||.    ..::||...:::    .:|.||:....|.:|:|....  |...:|:.:.
  Fly   130 TATPP----PSHNGILLHKQSSQQQQQQ----QQQLVGILDYHPLNGKLDYSS--SPKDQYEPQQ 184

  Fly    95 LSHADAQQLFRGAGNEIRLVVHRDNKIAYTQGATQEAGP----GSRSNSTLPPVTPDLMPHR--- 152
            |.|     |:.|:.:      |.|:....:.|..|::.|    |..:...|.  .||.|..:   
  Fly   185 LQH-----LYGGSPH------HLDHLDHGSDGLLQDSSPVMINGGSAGGKLK--KPDEMCSQLEA 236

  Fly   153 ---GPSPFLPGPSHFERALQLPVDTLPQTVFPQLNSSGGYEVPST------VFSPKPTRDHQQDV 208
               |.:|    ||.....:.   .|...|.....:||.|..:...      |.:|...:|.....
  Fly   237 GGAGVTP----PSSSSTVVN---GTTNGTGNANSSSSAGVGIQGAAGTAGGVAAPAAKKDGSSSK 294

  Fly   209 DEEQAAIVNQPYRTTPLVLPGAKVKKDAPTTESYLRHYPNPAVRAHPGHDYHDSIMKQRVADTML 273
            .:      ..|        .|.|.||...|..:|.......|....|   |.|...::.:|    
  Fly   295 KK------GDP--------NGIKKKKTRTTFTAYQLEELERAFERAP---YPDVFAREELA---- 338

  Fly   274 HKVVGSEA------DTGRVFHKQFNSP--IGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPL 330
            .|:..||:      ...|...::...|  .|....        ||.|.||.....|.......|.
  Fly   339 IKLNLSESRVQVWFQNRRAKWRKHEPPRKTGYIKT--------STPPTATLNPGTLAPPFTSYPQ 395

  Fly   331 PTKL---------NGYKKTVQYDPRNSETYRAIQEEGGYS-NYGQSSPQEVTIPVQTKVY-QPNR 384
            .|.:         ..|:...:..|:.|....|....|.|| .||....:....|::...| .|.|
  Fly   396 TTTVTPPGSMDSWTSYQTPYELTPQFSLLSPAASPYGTYSGQYGAYVHESQLFPMRHYEYGSPTR 460

  Fly   385 LVPGKKPVSAPVSRPPYNVVNTHDENIRQSGSF 417
            :..|....|         |....||::...||:
  Fly   461 MEMGATTGS---------VAGNGDESVANGGSY 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 9/46 (20%)
DUF4749 285..359 CDD:292558 15/84 (18%)
repoNP_477026.1 Homeobox 313..360 CDD:278475 10/53 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.