DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and lhx6a

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001004015.1 Gene:lhx6a / 445565 ZFINID:ZDB-GENE-041025-1 Length:375 Species:Danio rerio


Alignment Length:195 Identity:42/195 - (21%)
Similarity:68/195 - (34%) Gaps:69/195 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 CRRRSSSG---------LKKRVHF---ADEQNVGVQVGSPAHGELLRGDIISKIGEYD------- 91
            |:|:.|:|         :..|:|:   .:......:.||   |..|.|.:.|   |.|       
Zfish   189 CKRQLSTGEEFGLVEEKVLCRIHYDTMVENLKRAAESGS---GLTLEGAVPS---EQDSQPKPAK 247

  Fly    92 ------------------ARDLSHADAQQL-----FRGAGNEIRLVVHRDNKIAYTQGATQEAG- 132
                              |:| ::.|||.|     ..|....:..|..::.:..:.:...|..| 
Zfish   248 RARTSFTAEQLQVMQAQFAQD-NNPDAQTLQKLADMTGLSRRVIQVWFQNCRARHKKHTPQHNGP 311

  Fly   133 PGSRSNSTLPPVTPDLMPHRGPSPFLPGPSHFER--ALQLPVDTLPQTV------------FPQL 183
            |.:...:.:||..||.:.:   |||  |.....|  ||...:|:.|.:|            .|||
Zfish   312 PQAHPQARMPPSLPDELHY---SPF--GSPERARMVALHGYIDSHPFSVLTTQSLPHQAMTLPQL 371

  Fly   184  183
            Zfish   372  371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 15/76 (20%)
DUF4749 285..359 CDD:292558
lhx6aNP_001004015.1 LIM1_Lhx6 97..150 CDD:188766
LIM2_Lhx6 158..212 CDD:188768 5/22 (23%)
Homeobox 250..302 CDD:278475 8/52 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.