DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and ey

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster


Alignment Length:385 Identity:81/385 - (21%)
Similarity:129/385 - (33%) Gaps:116/385 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RRRSSSGLKKRVHFADEQNVGVQVGSPAHGELLRGDIISKIGEYDARDLSHADAQQLFRGAGNEI 111
            |.|:..|.|.||..|                    :::|||.:|      ..:...:|..   ||
  Fly   160 RPRAIGGSKPRVATA--------------------EVVSKISQY------KRECPSIFAW---EI 195

  Fly   112 R------LVVHRDN-----------KIAYTQGATQEAGPGSRSNSTLPPVTPDLMPHRGPSPFLP 159
            |      .|...||           :....|...|..|.||.|.|....::..:....|.:  :.
  Fly   196 RDRLLQENVCTNDNIPSVSSINRVLRNLAAQKEQQSTGSGSSSTSAGNSISAKVSVSIGGN--VS 258

  Fly   160 GPSHFERALQLPVDTLPQTVFPQLNS--SGGYEVPSTVFSPKPTRDHQQDVDEEQAAIVN----- 217
            ..:...|........|.||..| |||  |||        :.......:|:...|:..::|     
  Fly   259 NVASGSRGTLSSSTDLMQTATP-LNSSESGG--------ASNSGEGSEQEAIYEKLRLLNTQHAA 314

  Fly   218 -----QPYRTTPLVLPGAKVKKDAPTTESY--LRHYPNPAVRAH------PGHD----YHDSIMK 265
                 :|.|..|||   .:......|..|:  |.|..:.|::.|      |.|.    |..|:.:
  Fly   315 GPGPLEPARAAPLV---GQSPNHLGTRSSHPQLVHGNHQALQQHQQQSWPPRHYSGSWYPTSLSE 376

  Fly   266 QRVADTMLHKVVGSEADTGRVFHKQFNSPIGLYSNNNIEDTI----RSTVPFATSESNRLKDSPL 326
            ..::.......|.:.|....:.|       .|...|:||...    :...|.||.:        :
  Fly   377 IPISSAPNIASVTAYASGPSLAH-------SLSPPNDIESLASIGHQRNCPVATED--------I 426

  Fly   327 HRPLPTKLNGYK--KTVQYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNR 384
            |  |..:|:|::  :|...:..||        .||.||.|.:...:..:.::.|: |.||
  Fly   427 H--LKKELDGHQSDETGSGEGENS--------NGGASNIGNTEDDQARLILKRKL-QRNR 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 8/52 (15%)
DUF4749 285..359 CDD:292558 15/79 (19%)
eyNP_001014693.1 PAX 98..221 CDD:128645 18/89 (20%)
Homeobox 475..527 CDD:278475 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.