DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and CG34375

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001163693.1 Gene:CG34375 / 42715 FlyBaseID:FBgn0085404 Length:568 Species:Drosophila melanogaster


Alignment Length:185 Identity:38/185 - (20%)
Similarity:65/185 - (35%) Gaps:43/185 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 HRDNKIAYTQGATQEAGPGSRSNSTLPPVTPDLMPHRGPSPFLPGPSHFERALQ---LPVDTL-- 175
            |...|:|..:.::.::..|.:.:..|..|..|..|.........|... |:|:|   ||..||  
  Fly   218 HNQPKMALAKTSSGKSKCGKQISRQLETVLVDQSPREIRRKSQQGQEQ-EQAVQEAVLPRCTLIK 281

  Fly   176 ---PQTVFPQLNSSGGYEV---PSTVFSPKPTRDHQQDVD----EEQAAIVNQPYRTTPLVLPGA 230
               .:......:..|...:   |....|.|..|....|.|    :|.|.|.|           |.
  Fly   282 VQHQEAAVEHFSEEGHNNMLVKPKLKLSKKSWRITGPDQDGLRCDEVATINN-----------GV 335

  Fly   231 KVKKD-------------APTTESYLRHYPNPAVRAHPGHDYHDSIMKQRVADTM 272
            :|::.             :.::||..::|..|..::...|.|.   :.|.||:.:
  Fly   336 QVQEQQQQQERQQLGHEKSASSESEYQNYHCPTGKSCSSHSYQ---LGQPVANKL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492
DUF4749 285..359 CDD:292558
CG34375NP_001163693.1 PDZ 13..86 CDD:238080
RING 129..168 CDD:238093
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.