DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and loco

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_732773.1 Gene:loco / 42672 FlyBaseID:FBgn0020278 Length:1541 Species:Drosophila melanogaster


Alignment Length:295 Identity:57/295 - (19%)
Similarity:101/295 - (34%) Gaps:90/295 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 SHFERALQ-------LPVDTLPQTVFPQLNSSGGYEVPST---VFSPKP---------------- 200
            |.|||..:       :|...||:......:||...|..:|   |..||.                
  Fly  1284 SLFERMRRQQRDGGNIPASKLPKLKKKSTSSSQQSEEAATTQAVADPKKPIIAKLKAGVKLQVTE 1348

  Fly   201 -TRDHQQDVDE-----EQAAIVNQPYRTTPLVLPGAKVKKDAPTTESYLRHYPNPAVRAHPGHDY 259
             ..:||.::.|     :.|.:.:|         .|.::..|.|   .:|::..|.:...      
  Fly  1349 RVAEHQDELLEGLKRAQLARLEDQ---------RGTEINFDLP---DFLKNKENLSAAV------ 1395

  Fly   260 HDSIMKQRVADTMLHKVVGSEAD----TGRVFHKQFNSPIGLYSNNNIEDTIRSTVPFATSESNR 320
             ..:.|.|.:.:.:.||..:..:    ..|:...:...|:   |...::....:.:|.||.:...
  Fly  1396 -SKLRKVRASLSPVSKVPATPTEIPQPAPRLSITRSQQPV---SPMKVDQEPETDLPAATQDQTE 1456

  Fly   321 LKDSPLHRPLPTKLNGYKKTVQYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRL 385
            ...:|  .|||.|    .|.:...|.|   :...|..|.|.|                .|.|::.
  Fly  1457 FAKAP--PPLPPK----PKVLPIKPSN---WGVAQPTGNYCN----------------KYSPSKQ 1496

  Fly   386 VP-GKKPVSAP---VSRPPYNVVNTHDENIRQSGS 416
            || ..|..|.|   .|:.|.::..   :::.::||
  Fly  1497 VPTSPKEASKPGTFASKIPLDLGR---KSLEEAGS 1528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492
DUF4749 285..359 CDD:292558 15/73 (21%)
locoNP_732773.1 PDZ_signaling 69..145 CDD:238492
PTB_RGS12 251..391 CDD:269984
RGS_R12-like 828..941 CDD:188661
RGS12_RBD 1073..1145 CDD:176412
RBD 1144..1213 CDD:128731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.