DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Zasp66 and pitx3

DIOPT Version :9

Sequence 1:	NP_729395.2	Gene:	Zasp66 / 38988	FlyBaseID:	FBgn0035917	Length:	430	Species:	Drosophila melanogaster
Sequence 2:	NP_991238.1	Gene:	pitx3 / 402974	ZFINID:	ZDB-GENE-041229-4	Length:	293	Species:	Danio rerio

Alignment Length:	111	Identity:	25/111 - (22%)
Similarity:	37/111 - (33%)	Gaps:	34/111 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly    21 PGYELPTSYRPQPTPKPPLVPLPSPCRRRSSSGLKK-RVHFADEQNVGVQVGSPAHGELLRGDII 84
            |...|..|..||..|         .|:.:.:|..:| ..:..||.|       |..|.|.:
Zfish    14 PALSLSDSGTPQHDP---------GCKGQDNSDTEKSHQNHTDESN-------PEDGSLKK---- 58

  Fly    85 SKIGEYDARDLSHADAQQLFRGAGNEIRLVVHRDNKIAYTQGATQE 130
                 ...|..:|..:|||     .|:.....|:.   |...:|:|
Zfish    59 -----KQRRQRTHFTSQQL-----QELEATFQRNR---YPDMSTRE 91

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Zasp66	NP_729395.2	PDZ_signaling	<68..115	CDD:238492	9/46 (20%)
Zasp66	NP_729395.2	DUF4749	285..359	CDD:292558
pitx3	NP_991238.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..69		17/79 (22%)
		Cnd2	18..>79	CDD:303063	20/90 (22%)
		Homeobox	64..116	CDD:278475	9/36 (25%)
		OAR	251..268	CDD:281777
		OAR. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00138	255..268
		Nuclear localization signal. /evidence=ECO:0000250\|UniProtKB:O35160	260..264
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R6207
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.030