DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and dysc

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001261810.1 Gene:dysc / 39533 FlyBaseID:FBgn0264006 Length:1254 Species:Drosophila melanogaster


Alignment Length:325 Identity:53/325 - (16%)
Similarity:92/325 - (28%) Gaps:132/325 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GYELPTSYRPQPTPKPPLVPLPSPCRRRSSSGLKKRVHFADEQNVGVQVGSPAHGELLRGDIISK 86
            |.:|..:.:|.|||    :||   .:.::...|...:|    .|:..|.||.|           .
  Fly  1014 GIDLTETPKPMPTP----IPL---TKAKNPPPLPHELH----NNINSQYGSSA-----------A 1056

  Fly    87 IGEYDARDLSHADAQQLFRGAGNEIRLVVHRDNKI-----------------AYTQGATQEAGPG 134
            :..:.....:|...||       :.:...|.:.|.                 |.|.|:.|:..||
  Fly  1057 LSNHQPHQHTHPHPQQ-------QQQQQQHSNTKTPNTNSNKTQGTPTTGTGAATTGSKQQQQPG 1114

  Fly   135 SRSNSTLPPVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLPQTVFPQLNSSGGYEVPSTVFSPK 199
            :.:| |....:.:..|.|        ..|.:.|                               .
  Fly  1115 NTTN-TPTKASREATPTR--------EQHHQHA-------------------------------T 1139

  Fly   200 PTRDHQQDVDEEQAAI------------VNQPYRTTPLVLPGAKVKKDAP--------------- 237
            |||:|||.....|..:            ..|.:|.........:.:::..               
  Fly  1140 PTREHQQQTPTRQQQLQREQQQQLQREQQQQHHRDRQQHFREQREQREREYQHEHEHEQHHHHHH 1204

  Fly   238 TTESYLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQFNSPIGLYSNNN 302
            ..|.:.:|......:.||.|.:|.....|:.                   |::::|.....|:||
  Fly  1205 HREHHEQHQHQHGHQHHPQHQHHHQYSSQQQ-------------------HQRYSSSNSYKSHNN 1250

  Fly   303  302
              Fly  1251  1250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 7/46 (15%)
DUF4749 285..359 CDD:292558 5/18 (28%)
dyscNP_001261810.1 PDZ_signaling 294..380 CDD:238492
PDZ_signaling 466..543 CDD:238492
HN_L-whirlin_R2_like 573..653 CDD:259823
PDZ_signaling 886..971 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.