DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and pdlim7

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_957134.1 Gene:pdlim7 / 393813 ZFINID:ZDB-GENE-040426-2092 Length:419 Species:Danio rerio


Alignment Length:204 Identity:49/204 - (24%)
Similarity:71/204 - (34%) Gaps:61/204 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 ADEQNVGVQVGSPAHGELLRGDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHR-------D 118
            |.:..|||            ||.:..|.:.:|.:::|.:||...|.|.:.::|.:.|       :
Zfish    39 AAQAGVGV------------GDWVVSIFDANAEEMTHVEAQNKIRAATDSLKLTLSRAFHPAGGE 91

  Fly   119 NKIAYTQGATQ------------------EAGPGSRS-NSTLPPVT----PDL-MPHRG----PS 155
            .|.:.|..::|                  .|.|||.| ...:.||:    |.| .||.|    |.
Zfish    92 QKDSLTSSSSQPKYSFAPSTAINKMARPFSASPGSGSAGPVIKPVSYALKPALSSPHNGHGVAPC 156

  Fly   156 PFL----PGPSHFERALQLPVDTLPQTVFPQLNSSGGYEVPSTVFSPKPTRDHQQDVDEEQAAIV 216
            |..    |...|  .|:|.|...      |.  |||....|..|..|.....:..|.........
Zfish   157 PVTVKSKPADKH--DAVQAPAKA------PV--SSGPACRPPWVTDPGFADRYHPDKSSTVVTQH 211

  Fly   217 NQPYRTTPL 225
            .||.:.||:
Zfish   212 TQPLQPTPM 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 11/46 (24%)
DUF4749 285..359 CDD:292558
pdlim7NP_957134.1 PDZ_signaling 3..81 CDD:238492 14/53 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..232 13/55 (24%)
LIM1_Enigma 244..295 CDD:188836
LIM2_Enigma 303..354 CDD:188840
LIM3_Enigma 362..416 CDD:188842
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5287
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.180

Return to query results.
Submit another query.