DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and GRID2IP

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001138590.1 Gene:GRID2IP / 392862 HGNCID:18464 Length:1211 Species:Homo sapiens


Alignment Length:499 Identity:97/499 - (19%)
Similarity:155/499 - (31%) Gaps:168/499 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RSSASASFSRPAFWKVPGYELPTSYRPQPTPKPPLVPLPSPCRRRSS---------SGLKKRVH- 59
            |...|.|..||.       .|..|.|....|:.|..|.|    ||:|         .|.::.|. 
Human   229 RLRRSRSEERPE-------RLLVSTRASAPPRRPDEPPP----RRASLLVGGLAGPGGARRTVRV 282

  Fly    60 FADEQNVG-------------VQVGSPAHGELLR-GDIISKIGEYDARDLSHADAQQLFRGAGNE 110
            :...::.|             |..||||....|: ||.|..:...|.|:.||.....:.:|:|..
Human   283 YKGNKSFGFTLRGHGPVWIESVLPGSPADNAALKSGDRILFLNGLDMRNCSHDKVVSMLQGSGAM 347

  Fly   111 IRLVVHRDNKIAYTQGATQEAGPGSRSNST----LPPVTPDLMPHRGPS------PFLPGPSHFE 165
            ..||| .:..:.:...:.....|...|..|    :..:.|..:..:|.:      ..|..|..:.
Human   348 PTLVV-EEGLVPFASDSDSLDSPNPSSALTSLQWVAEILPSSIRVQGRTFSQQLEHLLTPPERYG 411

  Fly   166 --RALQ-----LPVDTLPQTVFPQLNSSG----------------------------GYEV---- 191
              |||:     ..:|||...|:|.|::..                            ||..    
Human   412 VCRALESFFQHRNIDTLIVDVYPVLDTPAKQVLWQFIYQLLTYEEQELCQEKIACFLGYTAMTAE 476

  Fly   192 --PSTVFSPKPTRDHQQDVDEEQAAIVNQPYRTTPL-----------------VLPGAKVKKDAP 237
              |......:||.:.|.......:::..:..|:..|                 ::||.:...|..
Human   477 PEPELDLESEPTPEPQPRSSLRASSMCRRSLRSQGLEAGLSCGPSECPEMPLPLIPGERQAGDGT 541

  Fly   238 TTESYLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQFNSPIGLYSNNN 302
            :    |...|||.:.:                      .|.:|.::.  .:..|...:|..|.:.
Human   542 S----LPETPNPKMMS----------------------AVYAELESR--LNSSFKGKMGTVSKSR 578

  Fly   303 IE--------DTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTVQYDPRNSETYRAIQEEGG 359
            ..        .|...|:...:..|.||..||.:.||.:  .|..     .|.:||::       .
Human   579 ASPPGPSPAVTTGPRTLSGVSWPSERLLPSPCYHPLCS--GGLA-----SPSSSESH-------P 629

  Fly   360 YSNYGQS---SPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPP 400
            |::...|   |||.          .|..:.|...|...| :|||
Human   630 YASLDSSRAPSPQP----------GPGPICPDSPPSPDP-TRPP 662

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 16/47 (34%)
DUF4749 285..359 CDD:292558 16/81 (20%)
GRID2IPNP_001138590.1 PDZ_signaling 14..74 CDD:238492
HN_L-delphilin-R1_like 133..212 CDD:259820
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..269 15/50 (30%)
PDZ_signaling 278..353 CDD:238492 20/75 (27%)
HN_L-delphilin-R2_like 389..468 CDD:259821 12/78 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 478..502 4/23 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 525..549 5/27 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 568..600 4/31 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 618..672 16/68 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 718..783
FH2 820..1188 CDD:280362
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.