DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and Zasp67

DIOPT Version :10

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster


Alignment Length:388 Identity:82/388 - (21%)
Similarity:140/388 - (36%) Gaps:106/388 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 ADEQNVGVQVGSPAHGELLRGDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHRDN-KIAYT 124
            |||..:.|:            |||.:|.:..|..|:|.:|.:|..|:|:.....|:|:| :.||.
  Fly    40 ADEAGLRVE------------DIIVRINDTAATPLTHDEAHRLIMGSGSVFYFGVYRENEEDAYE 92

  Fly   125 QGATQEAGPGSRSNSTLPPVTPDLMPHRG------------PSPFLPGPSHFER------ALQLP 171
            .........||.:.|.:|.::|...|...            |.||:|.|.....      |:::.
  Fly    93 CLKKFPTSEGSLTKSPMPTISPSPTPSLSQLTETTNARTPEPEPFVPLPRELAAATMAAPAVEVD 157

  Fly   172 VDTLPQTVFPQLNSSGGYEVPSTVFSPKPTRDHQQDVDEEQAAIVNQPYRTTPLVLPGAKVKKDA 236
            ||.|.:...|.          |.|.|    .:.:.||:...|              ||...:...
  Fly   158 VDVLAECRQPM----------SEVHS----EEKRGDVNGHDA--------------PGQADEGGL 194

  Fly   237 PTTESYLRHYPNPAVRAHPGHDYHDSIMKQR----VADTMLHKVVGSEADT-------GRVFHKQ 290
            |....||...|          |...|.:.:|    :.:..:..|:..|::.       |..|::.
  Fly   195 PVENLYLPDLP----------DRPCSALSERQEIKLVEEEIAAVLSGESEVLKEHNVLGVNFYRI 249

  Fly   291 FNSPIGLYSNNNIEDTIRSTV---PFATSESNRLKDSPL---HRPLPTKLNGYKKTVQYDPRNSE 349
            |..| |:..::::..::...|   .....:.||...:.|   :||:|..    |::::.:.|.:.
  Fly   250 FPKP-GVCMSSDVLRSLNEEVTKTKLEKDKENRQWSTFLQRPNRPVPKS----KQSLEAERRAAN 309

  Fly   350 TYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGK---KPVSAPVSRPPYNVVNTHDE 409
            .|:.        ...:|:|:|.: |:......|....|.|   |....||   |..||....|
  Fly   310 AYKV--------TIVKSAPREKS-PMPEAKPAPKEATPPKEVEKKEEEPV---PEEVVEPEPE 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_canonical <68..117 CDD:483948 13/48 (27%)
DUF4749 285..374 CDD:464948 17/94 (18%)
Zasp67NP_648358.2 PDZ_ZASP52-like 4..84 CDD:467281 16/55 (29%)
DUF4749 653..>699 CDD:464948
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.