DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and Zasp67

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster


Alignment Length:388 Identity:82/388 - (21%)
Similarity:140/388 - (36%) Gaps:106/388 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 ADEQNVGVQVGSPAHGELLRGDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHRDN-KIAYT 124
            |||..:.|:            |||.:|.:..|..|:|.:|.:|..|:|:.....|:|:| :.||.
  Fly    40 ADEAGLRVE------------DIIVRINDTAATPLTHDEAHRLIMGSGSVFYFGVYRENEEDAYE 92

  Fly   125 QGATQEAGPGSRSNSTLPPVTPDLMPHRG------------PSPFLPGPSHFER------ALQLP 171
            .........||.:.|.:|.::|...|...            |.||:|.|.....      |:::.
  Fly    93 CLKKFPTSEGSLTKSPMPTISPSPTPSLSQLTETTNARTPEPEPFVPLPRELAAATMAAPAVEVD 157

  Fly   172 VDTLPQTVFPQLNSSGGYEVPSTVFSPKPTRDHQQDVDEEQAAIVNQPYRTTPLVLPGAKVKKDA 236
            ||.|.:...|.          |.|.|    .:.:.||:...|              ||...:...
  Fly   158 VDVLAECRQPM----------SEVHS----EEKRGDVNGHDA--------------PGQADEGGL 194

  Fly   237 PTTESYLRHYPNPAVRAHPGHDYHDSIMKQR----VADTMLHKVVGSEADT-------GRVFHKQ 290
            |....||...|          |...|.:.:|    :.:..:..|:..|::.       |..|::.
  Fly   195 PVENLYLPDLP----------DRPCSALSERQEIKLVEEEIAAVLSGESEVLKEHNVLGVNFYRI 249

  Fly   291 FNSPIGLYSNNNIEDTIRSTV---PFATSESNRLKDSPL---HRPLPTKLNGYKKTVQYDPRNSE 349
            |..| |:..::::..::...|   .....:.||...:.|   :||:|..    |::::.:.|.:.
  Fly   250 FPKP-GVCMSSDVLRSLNEEVTKTKLEKDKENRQWSTFLQRPNRPVPKS----KQSLEAERRAAN 309

  Fly   350 TYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGK---KPVSAPVSRPPYNVVNTHDE 409
            .|:.        ...:|:|:|.: |:......|....|.|   |....||   |..||....|
  Fly   310 AYKV--------TIVKSAPREKS-PMPEAKPAPKEATPPKEVEKKEEEPV---PEEVVEPEPE 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 12/46 (26%)
DUF4749 285..359 CDD:292558 14/79 (18%)
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492 14/46 (30%)
DUF4749 653..>699 CDD:292558
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24214
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.