DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and ssp6

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001286952.1 Gene:ssp6 / 38694 FlyBaseID:FBgn0035676 Length:866 Species:Drosophila melanogaster


Alignment Length:327 Identity:62/327 - (18%)
Similarity:101/327 - (30%) Gaps:123/327 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PSPCRRRSSSGLKKR------------VHFADEQNVG-------VQVGSPAHGELLR-GDIISKI 87
            |...|||.:..::|:            :|:..::.:.       |:.|.||:...:| ||:|..|
  Fly   123 PDEDRRRRTIIVEKKNNSYGFTLQSYGIHYKRDEELEMITYVDYVEYGGPAYRAGMREGDVILSI 187

  Fly    88 GEYDARDLSHAD------------------------------------AQQLFRGAGNEIRLVVH 116
               :.:|:..||                                    .|.:.:...||:..|..
  Fly   188 ---NGKDMEKADHKTIVEFIKQCDTRMRMVVLFEDCVRKVDLHMRYIQLQSMLQQKMNELERVHL 249

  Fly   117 RDNKIAYTQGATQEAGPGSRSNSTLPPVTPDLMPHRGPSPF-LPGPSHFERALQLPVDTLPQTVF 180
            |:.::...:..|.......::|:...|...:     |.||. :.|.:.|.|. .|..:.:|....
  Fly   250 RERELLEGKWKTHSLPARKKANANTSPSDGE-----GVSPTEVAGEAGFYRP-ALSTEDVPNIAA 308

  Fly   181 PQLNSSGG---------------YEVPSTVFSPKPTR-----------------DHQ-------- 205
            .| :..||               |..|:..:..:||.                 |||        
  Fly   309 RQ-HGVGGPGIIPPPAQFMLTYHYLDPTYRYVLRPTHGSSEEFVDGLGLQRSSSDHQPPAQRYVL 372

  Fly   206 QDVDEEQAAIVNQPYRTTPL---VLPGAKVKKDAPTTESYLRHYPNPA------------VRAHP 255
            |..:...|..:.||..|.|.   ...|..||..||...:..:|.| ||            ...|.
  Fly   373 QQTESVDANSMTQPTTTAPTQYHSTTGGSVKPPAPPPRTCEKHKP-PAKPPKPEKEKSSGKHCHV 436

  Fly   256 GH 257
            ||
  Fly   437 GH 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 15/83 (18%)
DUF4749 285..359 CDD:292558
ssp6NP_001286952.1 PDZ_signaling 130..216 CDD:238492 14/88 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.