DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and CG15617

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster


Alignment Length:275 Identity:57/275 - (20%)
Similarity:92/275 - (33%) Gaps:88/275 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FSRPAFWKVPGYELPTSYRPQPTPKPPLVPLPSPCRRRS----------SSGLKKRVHFADEQNV 66
            :...||..| .|||..:|           .|.:.||..|          :.|:.:   |.....|
  Fly    11 YDSDAFDNV-AYELQMTY-----------TLETDCRIMSFYDAMWGMEVTGGIDQ---FEPLTIV 60

  Fly    67 GVQ-VGSPAHGELLRGDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHRDNKIAYTQGATQE 130
            .|. .|....|.:..||.|::|.:..|.:::..:|.|:||.....:|:.|..|           :
  Fly    61 NVSPTGLAKRGGMRVGDEITQINDVPALEMTFNEALQMFRKNSRYVRVYVRGD-----------D 114

  Fly   131 AGPGSRS---NSTLPPVTP---DLMPHRGPSPFLPGPSHFERALQLPVDTLPQTVFPQLNSSGGY 189
            ..||...   :....|..|   |..|.:...|:     :..|.             |....|..:
  Fly   115 DAPGEEDWTCDCWFKPRKPWRRDFTPIQWTFPW-----NDRRK-------------PVYKESNCF 161

  Fly   190 EVPSTVFSPKPTRDHQQDVDEEQAAIVNQPYRTTPLVLPGAKVKKD--APTTESYLRHYPNPAVR 252
            .|||.:         ::.:...:||             ..|..|||  ||.|.|..   |.|..:
  Fly   162 MVPSKM---------EEKIRARRAA-------------TSAVHKKDELAPHTRSLT---PTPRPK 201

  Fly   253 AHPGHDYHDSIMKQR 267
            ..||.:..:::::.|
  Fly   202 NQPGPNLLETVLRPR 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 13/47 (28%)
DUF4749 285..359 CDD:292558
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 19/83 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.