DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and CG42319

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster


Alignment Length:340 Identity:74/340 - (21%)
Similarity:118/340 - (34%) Gaps:62/340 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 GDIISKIGEYDARDLSHADAQQLFRGAGNEIRLV---VHRDNKIAYTQGATQEAGPGSRSNSTLP 142
            ||||.:|.|.||..|:.:.|.:.......:|..:   :..|:.:...:...:::           
  Fly    84 GDIILEINEEDASQLTLSQAHEKINSTPKKIHFLLRNMEEDDPMGQFEAGEEKS----------- 137

  Fly   143 PVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLPQTVFPQLNSSGGYEVPSTVFSPKPT------ 201
                  :..|.|.| ||.||...||..:.:..|..    |...|...|:|..:.|...|      
  Fly   138 ------IVMRVPKP-LPPPSGRIRASSIEMRLLEM----QRKLSAIAEIPKILCSTLATVSQNFG 191

  Fly   202 RDHQQDVDE----EQAAIVNQPYR----TTPLVLPGAKVKKDAPTTESYLRHYPNPAVRAHPGHD 258
            |..:.:|||    |:.|.|.:.:.    .....|...:...|..:.|..|     ..||.   .|
  Fly   192 RMSESEVDEDDVGEEEAYVQRKFSYDEDALDFELRNGEQAGDTDSDEEDL-----VLVRE---ED 248

  Fly   259 YHDSIMKQRVADTMLHKVVGSEADTGRVFHKQFNSPIGLYSN---NNIEDTIRSTVPFATSESNR 320
            ..|..:.:....:.|.|.|..|:|    :..:.|.|....|:   ::.||...|||.|....:..
  Fly   249 AEDVDVPKGAKQSKLLKDVTPESD----YASEANYPANEASDDTESDDEDEPGSTVYFMKLPAAA 309

  Fly   321 LKDSPLHRPLPTKLNGYKKTVQYDPRNSETYRAIQEEG-GYSNYGQSSPQEVTIPVQTKVYQPNR 384
            .:|:..........:....|..::.||....|....|. |....|..:.:   :|.|.   ||..
  Fly   310 AEDTYSSTEDEDDSDFLNTTYTWNLRNVPKLRINDAEAEGELTLGHQARE---VPQQE---QPQE 368

  Fly   385 LVPGKKPVSAPVSRP 399
            ..|..:| ..|..||
  Fly   369 KQPCLEP-EPPKVRP 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 11/36 (31%)
DUF4749 285..359 CDD:292558 15/77 (19%)
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 11/34 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24214
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.