DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and Lnx1

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001101828.1 Gene:Lnx1 / 360926 RGDID:1308159 Length:728 Species:Rattus norvegicus


Alignment Length:413 Identity:93/413 - (22%)
Similarity:143/413 - (34%) Gaps:127/413 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SRSSASASFSRPAFWKVPGYELPTSYRPQPTPKPPLVPLPSPCRRRSSSGLK--KRVHFADEQNV 66
            |||:|.|               |.||.|:......::...||   ....|:|  :||   ||..|
  Rat   367 SRSNAPA---------------PDSYGPRDDSFHVILNKSSP---EEQLGIKLVRRV---DEPGV 410

  Fly    67 ---GVQVGSPA--HGELLRGDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHRDNKIAYTQG 126
               .|..|..|  ||:|...|.:..|..:|.|..|...|..|.:.:...:.|||.|..: ..:..
  Rat   411 FIFNVLNGGVADRHGQLEENDRVLAINGHDLRFGSPESAAHLIQASERRVHLVVSRQVR-QPSPD 474

  Fly   127 ATQEAG----------PGSRSNSTLPPVTPDLMPHRGPSPFLPGPSHFERALQL---PVDTLPQT 178
            ..||||          .|.||.|:.|..|                .| |:.:.:   |.::|..|
  Rat   475 IFQEAGCISNGQQSPVSGERSTSSKPAAT----------------CH-EKVVSVQKDPNESLGMT 522

  Fly   179 VFPQLNSSGG-----YEVPSTVFSPKP----TRDHQQDVDEEQAAIVNQPYRTTPLVLPGAKVK- 233
            |      .||     :::|..|.|.:|    :||.:              .:|..::|....:: 
  Rat   523 V------GGGASHREWDLPIYVISVEPGGVISRDGR--------------IKTGDILLNVNGIEL 567

  Fly   234 KDAPTTESYLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQFNSPIGLY 298
            .:...||:.                   :|:|...:..:|..:...|.:|     ::..||..|.
  Rat   568 TEVSRTEAV-------------------AILKSTPSSVVLKALEVKEQET-----QEDCSPAALD 608

  Fly   299 SNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTVQYDPRNSETYRAIQEEGGYSNY 363
            ||:|:      |.|...|.|     ..:...||..|...|..:.  .||:.........|||..|
  Rat   609 SNHNV------TPPGDWSPS-----WVMWLELPQYLYNCKDVIL--RRNTAGSLGFCIVGGYEEY 660

  Fly   364 GQSSPQEVTIPVQ-TKVYQPNRL 385
            ..:.|..:...|: |..|...|:
  Rat   661 SGNQPFFIKSIVEGTPAYNDGRI 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 14/48 (29%)
DUF4749 285..359 CDD:292558 16/73 (22%)
Lnx1NP_001101828.1 RING 45..81 CDD:214546
DegQ <260..364 CDD:223343
PDZ_signaling 276..360 CDD:238492
PDZ_signaling 384..464 CDD:238492 23/85 (27%)
PDZ_signaling 506..589 CDD:238492 19/121 (16%)
PDZ_signaling 637..721 CDD:238492 12/49 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.