DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and Lnx2

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001101799.1 Gene:Lnx2 / 360761 RGDID:1308222 Length:686 Species:Rattus norvegicus


Alignment Length:280 Identity:60/280 - (21%)
Similarity:100/280 - (35%) Gaps:76/280 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 KRVHFADEQNVGV----QVGSPAH-GELLRGDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVV 115
            |.|...||..|.:    :.|..|. |.|...|.:..|..:|.:..:...|..:.:.:|..:.|.:
  Rat   353 KLVRRTDEPGVFILDLLEGGLAAQDGRLSSNDRVLAINGHDLKQGTPELAAHIIQASGERVNLTI 417

  Fly   116 HRDNKIAYTQGATQEAGPGSRSNSTLPPVTPDLMPHRGPSPFLPGPSH---------FERALQL- 170
            .|..|...:.| ::|||..| ||...||      .|..||      ||         .|:.:.: 
  Rat   418 ARPGKPQPSNG-SREAGAHS-SNHAQPP------SHSRPS------SHKDLTRCVTCQEKHITVK 468

  Fly   171 --PVDTLPQTVFPQLNSSGGYEVPSTVFSPKP----TRDHQ---------------QDVDEEQAA 214
              |.::|..||.....|..| |:|..|.|..|    .||.:               .::...:|.
  Rat   469 KEPHESLGMTVAGGRGSKSG-ELPIFVTSVPPHGCLARDGRIKRGDVLLNINGIDLTNLSHSEAV 532

  Fly   215 IVNQPYRTTPLVL-------------------PGA--KVKKDAPTTESYLRHYPNPAVRAHPGHD 258
            .:.:....:|.|:                   |||  :.:.||..:.|::.....|:..    |.
  Rat   533 AMLKASAASPAVILKALEVQIAEEAAQATEEQPGAFSENEYDASWSPSWVMWLGLPSAL----HS 593

  Fly   259 YHDSIMKQRVADTMLHKVVG 278
            .||.::::....:....:||
  Rat   594 CHDIVLRRSYLGSWGFSIVG 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 10/51 (20%)
DUF4749 285..359 CDD:292558
Lnx2NP_001101799.1 mRING-HC-C3HC3D_LNX2 46..90 CDD:319694
PDZ 229..315 CDD:214570
PDZ 335..421 CDD:214570 16/67 (24%)
PDZ_signaling 462..538 CDD:238492 15/76 (20%)
PDZ_signaling 595..679 CDD:238492 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.