DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and pdzk1

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001122142.2 Gene:pdzk1 / 337325 ZFINID:ZDB-GENE-031222-1 Length:553 Species:Danio rerio


Alignment Length:209 Identity:49/209 - (23%)
Similarity:78/209 - (37%) Gaps:61/209 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VPGYELPTSYRPQPTPKPPLVPLPSP--------------CR-RRSSSGLKKRVHFADEQNVG-- 67
            ||...:..:..|..||.|...|.|.|              || .|:|:|.  ..|....|.|.  
Zfish   355 VPAAVVAATPAPAATPAPAATPTPVPAAAEPADVDHKPKLCRLERTSAGF--GFHLNGIQGVPGQ 417

  Fly    68 -----VQVGSPAHGELLRGDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHRDNKIAY---- 123
                 |:.|:.....|:..|::.::...:....:|.:...|.|.:|:.:.|:| .|.| ||    
Zfish   418 HIQEVVKGGAADRAGLVDDDVVVEVDGVNVEMSTHEEVVNLIRNSGDTLVLLV-ADRK-AYEHLK 480

  Fly   124 TQGATQEAGPGSRSNSTLPPVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLPQTVFPQLNSSGG 188
            .:|.               |:||.|: ::.|:..:|.|::.:      ||....|       ...
Zfish   481 AKGI---------------PITPQLL-NKEPAADVPAPAYTQ------VDGRKDT-------EKD 516

  Fly   189 YEVPSTVFSPKPTR 202
            .|.|:|  .|.|||
Zfish   517 IEKPAT--PPAPTR 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 9/46 (20%)
DUF4749 285..359 CDD:292558
pdzk1NP_001122142.2 PDZ_signaling 6..86 CDD:238492
PDZ_signaling 126..204 CDD:238492
PDZ 232..311 CDD:214570
PDZ_signaling 392..471 CDD:238492 18/81 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.