DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and CG43707

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001260005.1 Gene:CG43707 / 33601 FlyBaseID:FBgn0263846 Length:2021 Species:Drosophila melanogaster


Alignment Length:495 Identity:89/495 - (17%)
Similarity:139/495 - (28%) Gaps:214/495 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YELPTSYRPQPT----PKPPLVPLPSPCRRRSSSGLKKRVHFADEQNVGVQVGSPAHGELLRGDI 83
            ||...|..|.||    |..|    .||||              ||                   :
  Fly   820 YEAKASETPTPTGLRLPSTP----ASPCR--------------DE-------------------L 847

  Fly    84 ISKIGEYDARD-LSHADAQQLFRGAGNEIRLVVHRDNKIAYTQGATQEAGPGSRSNSTLPPVTPD 147
            ::.:..|.:.| |::.:.:....|..||        :::.......::...||.|::.|  :||.
  Fly   848 LANVSTYPSSDSLANDNTRDHSDGIWNE--------SQVTVLTAEQRDISDGSYSSNLL--LTPS 902

  Fly   148 ------LMPHRGPSPFLPGPSHFER-----ALQ---------LPVDTLPQTVFPQLNSSGGYEVP 192
                  |:.|:..|........||.     .||         .|..:.|.:..|.:........|
  Fly   903 SKRKNLLLQHQQRSSVDTDALDFEEQSPTYGLQTLPKIIKTPTPTTSRPTSTQPMMPPPAIAVTP 967

  Fly   193 ST-------VFSPKPTR------------------------------------DHQQDVDEEQAA 214
            ||       :.||.|.|                                    |:.:..|..:.:
  Fly   968 STNQILDSCISSPLPKRSMVARGSVPDARQLMFTSGATKQRHSDASFLPMGAADYARSADISECS 1032

  Fly   215 IVNQPYRT-------TPLVLPGAKVKKDAPTTESYLRHYPNPAVRAHPGHDY------------- 259
            .....|.|       ||:....::::|                  .|.|..:             
  Fly  1033 TNTDEYATCTDTSKRTPVSTQSSQLEK------------------THAGSSFESASSLYSMREDL 1079

  Fly   260 --HDSIMKQRVADTMLHKVVGSEADTGRVFHKQFNSPIGLYSNNNIEDTIRSTVPFATSESNRLK 322
              ||.  |:|...|.|.|.             |..||||                   |.:...:
  Fly  1080 LQHDE--KERDKQTTLTKA-------------QLKSPIG-------------------SVAELTR 1110

  Fly   323 DSPLHRPLPTKLNGYKKTVQYDPRNSETYRAIQEEGGYSNYGQSSPQEV--TIPVQTKVYQPNRL 385
            .||.|....|..:|....:.         .||:     |...:|.||.|  ::..|.||.....:
  Fly  1111 KSPSHSISSTTSSGSCPVLG---------AAIK-----SPAKESLPQTVASSVTSQMKVSSVECI 1161

  Fly   386 VPGKKPVSAPVSRPPYNVV---------NTHDENIRQSGS 416
            .||.||....:|....:.|         :.|:|:..:.|:
  Fly  1162 PPGVKPKPDSISEDERSEVRYSSSGYYESPHEEDDEEQGT 1201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 6/47 (13%)
DUF4749 285..359 CDD:292558 13/73 (18%)
CG43707NP_001260005.1 PHA03369 <987..1394 CDD:223061 46/281 (16%)
PDZ_signaling 1702..1775 CDD:238492
PH 1792..1894 CDD:278594
PH-like 1792..1893 CDD:302622
PH-like 1911..2011 CDD:302622
PH 1921..2014 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.