DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and ldb3b

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_005156328.1 Gene:ldb3b / 334100 ZFINID:ZDB-GENE-030131-6032 Length:308 Species:Danio rerio


Alignment Length:295 Identity:62/295 - (21%)
Similarity:90/295 - (30%) Gaps:120/295 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 AHGELLRGDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHRDNKIAYTQGATQEAGPGSRSN 138
            |.|.|.:||||:.|.......::|.:||...:.|..::.|.:.|                 ||..
Zfish    40 ASGNLNQGDIITAIDGVSTEGMTHLEAQNKIKAATTKLSLTMQR-----------------SRRP 87

  Fly   139 STLPPVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLPQTVFPQLNSSGGYEVPSTVFSPKPTRD 203
            :.:|..||.:   ..|.|.:|                                     ..|.|.|
Zfish    88 APVPTATPRM---DSPMPVIP-------------------------------------HQKETTD 112

  Fly   204 HQQDVDEEQAAIVNQPYRTTPLVLPGAKVKKD-APTTESYLRHYPNPAVRAHPGHDYHDSIMKQR 267
            .....|||      ||.:...::|.....||. .|.||                         ::
Zfish   113 TGDGEDEE------QPVKKYGILLAKKPSKKSLIPNTE-------------------------EK 146

  Fly   268 VADTMLHKVVGSEADTGRVFHK----------QFNSPIGLYSNNNIEDTIRSTVPFATSESNRLK 322
            ..:..:|....|...|...|.:          |:||||||||    .:|:|..|    .:.:.|.
Zfish   147 PQENAIHSPAKSPVPTYLPFGQGMKTTPNQRGQYNSPIGLYS----AETLREMV----MQQDSLN 203

  Fly   323 DSPLHRPLPTKLNGYKKTVQYDP---RNSETYRAI 354
            ..|....||.|          ||   ..|..|:|:
Zfish   204 GLPFLGSLPIK----------DPLVDSASPVYQAV 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 13/40 (33%)
DUF4749 285..359 CDD:292558 23/83 (28%)
ldb3bXP_005156328.1 PDZ_signaling 4..82 CDD:238492 13/41 (32%)
DUF4749 179..267 CDD:292558 22/68 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5287
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.