DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and HOXB8

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_076921.1 Gene:HOXB8 / 3218 HGNCID:5119 Length:243 Species:Homo sapiens


Alignment Length:154 Identity:29/154 - (18%)
Similarity:53/154 - (34%) Gaps:55/154 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 PSHFERALQLPVDTLPQTVFPQLNSSGGYEVPSTVFSPKPTRDHQQDVDEEQAAIVNQPYRTTPL 225
            |::::......:...|..|:.. :|.|.::.||.:          |:.....:::...||:..|.
Human    21 PNYYDCGFAQDLGGRPTVVYGP-SSGGSFQHPSQI----------QEFYHGPSSLSTAPYQQNPC 74

  Fly   226 VLPGAKVKKDAPTTESYLRHYPNPAVRAH--PGHDY-HDSIMKQ-----------RVADTMLHKV 276
                                    ||..|  ||:.| :|.:.:|           :.||..|...
Human    75 ------------------------AVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAA 115

  Fly   277 --VGSEADTGRVFHKQFNSPIGLY 298
              :|.||:..    :|..||..|:
Human   116 SGLGEEAEGS----EQSPSPTQLF 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492
DUF4749 285..359 CDD:292558 4/14 (29%)
HOXB8NP_076921.1 Antp-type hexapeptide 134..139 1/2 (50%)
Homeobox 150..203 CDD:395001
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..243
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.