DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and Whrn

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_038965801.1 Gene:Whrn / 313255 RGDID:631330 Length:969 Species:Rattus norvegicus


Alignment Length:152 Identity:44/152 - (28%)
Similarity:62/152 - (40%) Gaps:34/152 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GYELP--TSYRPQPT------PKPPLVPLPSPCRRRSSSGLKKRVHFADEQNVGVQV-----GSP 73
            |..||  |.|| ||.      ..|..|.|.|..|.::..||...:....|..||:.|     ||.
  Rat   114 GLYLPATTPYR-QPAWAAPDGAGPGEVRLVSLRRAKAHEGLGFSIRGGSEHGVGIYVSLVEPGSL 177

  Fly    74 AHGELLR-GDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHRDNKI--------AYTQGATQ 129
            |..|.|| ||.|.::.:.....::||:|.:..:|: .::.|.|:...:|        .||.    
  Rat   178 AEKEGLRVGDQILRVNDKSLARVTHAEAVKALKGS-KKLVLSVYSAGRIPGGYVTNHIYTW---- 237

  Fly   130 EAGPGSRSNSTLPPVTPDLMPH 151
             ..|..||.|     .|..:||
  Rat   238 -VDPQGRSTS-----PPSSLPH 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 15/52 (29%)
DUF4749 285..359 CDD:292558
WhrnXP_038965801.1 HN_L-whirlin_R1_like 38..113 CDD:259822
PDZ_signaling 139..216 CDD:238492 23/77 (30%)
PDZ_signaling 276..356 CDD:238492
HN_L-whirlin_R2_like 418..498 CDD:259823
PDZ_signaling <908..949 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.