DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and PsGEF

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_996333.4 Gene:PsGEF / 31224 FlyBaseID:FBgn0264598 Length:2777 Species:Drosophila melanogaster


Alignment Length:419 Identity:80/419 - (19%)
Similarity:138/419 - (32%) Gaps:95/419 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PSPCRRRSSSGLKKRVHFADEQN---VGVQVGS--PAHGELLRGDIISKIGEYDAR----DLSHA 98
            |:.| .:.|:|:......|:.:|   .|...||  ......:.|::.||:....:|    | :.:
  Fly  1470 PNRC-CKLSNGIAGATEMANPKNSNRTGTGTGSVTSMSSSTITGELSSKVVASSSRRETGD-TES 1532

  Fly    99 DAQQLFRGAGNEIRLVVHRDNKIAYTQGATQEAGPGSRSNSTL------PPVTPDLMPHRGPSPF 157
            |..||.             .::|:.:|....:...|:..||:.      |.:|...:.|..|   
  Fly  1533 DVAQLI-------------TDEISQSQSEATDDSVGAMPNSSRSAGEGNPVITGSRLRHLDP--- 1581

  Fly   158 LPGPSHFERALQLPVDTLPQTVFPQLNSSGGYEVPSTVFSPKPTRDHQQDVDEEQAAIVNQPYRT 222
                       .:.|.:||.   ...::..|...|..:..|:.||...|...|......||..:.
  Fly  1582 -----------PVSVSSLPN---GHCSAGVGGGSPKPLPPPRRTRVVAQMCQEPPRPKANQQVKA 1632

  Fly   223 TPLVLPGAKVKKDAPTTES---------YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLH---K 275
            ...:...|::.:.:||..|         .:...|......|......|....|...|.|.|   |
  Fly  1633 IVTITETARIMRSSPTKGSGSGSATGTGSVGGSPAKYAACHCRCTPEDFTHAQLSPDKMEHQTCK 1697

  Fly   276 VVGSEADTGRVF-HKQFNSPIGLYSNNNIEDTIRSTVPFAT--------SESNRLKDSPLHRPLP 331
            ::.|...|.... .||.:..:.|....     :....|.||        .|.|......:..|.|
  Fly  1698 LLESPKQTTTTLEQKQEDEQLSLMLIG-----LAQLAPAATLCGQERIPKEENSTPTIAVVPPTP 1757

  Fly   332 TKLNGYKKTVQYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRL----VPGKKPV 392
                        |...::|...:.:..|.|:.|..:....|....||  ||.:.    :|.....
  Fly  1758 ------------DSVLTKTSTHVWDNSGCSSNGGGTSTTSTATTTTK--QPRQAIIENIPEDSCD 1808

  Fly   393 SAPV-SRPPYNVVNTHDENIRQSGSFNRL 420
            .:|: ..|||..:::   .:|:.|:.:.|
  Fly  1809 ESPLDEEPPYRPMSS---ALRRFGTMSSL 1834

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 10/52 (19%)
DUF4749 285..359 CDD:292558 12/82 (15%)
PsGEFNP_996333.4 DUF4799 <102..209 CDD:292674
C2 286..>381 CDD:278593
PDZ_signaling 644..716 CDD:238492
RhoGEF 831..1000 CDD:295373
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.