Sequence 1: | NP_729395.2 | Gene: | Zasp66 / 38988 | FlyBaseID: | FBgn0035917 | Length: | 430 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001101101.2 | Gene: | Gopc / 309774 | RGDID: | 1309512 | Length: | 463 | Species: | Rattus norvegicus |
Alignment Length: | 212 | Identity: | 34/212 - (16%) |
---|---|---|---|
Similarity: | 76/212 - (35%) | Gaps: | 59/212 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 258 DYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQFNSPIGLYSNNNIEDTIRSTVPFATSESN--- 319
Fly 320 -----RLKDSPLHR---PLPTKLNGYKKTVQY-DPRNSETYRAIQEEGGYSNYGQSSPQEVTIPV 375
Fly 376 QTKVYQP-------------NRLVPGKKPVSAPVSRPPYNVVNTHD-ENIRQS---GSFNRLM-- 421
Fly 422 --------YSVIGATEY 430 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Zasp66 | NP_729395.2 | PDZ_signaling | <68..115 | CDD:238492 | |
DUF4749 | 285..359 | CDD:292558 | 12/85 (14%) | ||
Gopc | NP_001101101.2 | SMC_prok_B | <35..>215 | CDD:274008 | 17/100 (17%) |
PDZ_signaling | 287..369 | CDD:238492 | 3/24 (13%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |