DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and Gopc

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001101101.2 Gene:Gopc / 309774 RGDID:1309512 Length:463 Species:Rattus norvegicus


Alignment Length:212 Identity:34/212 - (16%)
Similarity:76/212 - (35%) Gaps:59/212 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 DYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQFNSPIGLYSNNNIEDTIRSTVPFATSESN--- 319
            :.||.:::.......||...|...|:|.:     .:.:.::|..::|..:.:.......|:.   
  Rat   119 EVHDQLLQLHSTQLQLHAKTGQSVDSGAI-----KAKLSVHSMEDLERELEANKTEKVKEARLEA 178

  Fly   320 -----RLKDSPLHR---PLPTKLNGYKKTVQY-DPRNSETYRAIQEEGGYSNYGQSSPQEVTIPV 375
                 |.::..|.|   .|..::.|.:...:| |...:...:.||..|          :::..|.
  Rat   179 EVKLLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLG----------RDMKGPA 233

  Fly   376 QTKVYQP-------------NRLVPGKKPVSAPVSRPPYNVVNTHD-ENIRQS---GSFNRLM-- 421
            ..|::..             .|...|::.:..|:..||     .|| :::::|   |...:::  
  Rat   234 HDKLWNQLEAEIHLHRHKTVIRACRGRQDLKRPMQAPP-----GHDQDSLKKSQGVGPIRKVLLL 293

  Fly   422 --------YSVIGATEY 430
                    .|:.|..|:
  Rat   294 KEDHEGLGISITGGKEH 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492
DUF4749 285..359 CDD:292558 12/85 (14%)
GopcNP_001101101.2 SMC_prok_B <35..>215 CDD:274008 17/100 (17%)
PDZ_signaling 287..369 CDD:238492 3/24 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.