DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and Ush1c

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_006229284.1 Gene:Ush1c / 308596 RGDID:1303329 Length:910 Species:Rattus norvegicus


Alignment Length:325 Identity:65/325 - (20%)
Similarity:115/325 - (35%) Gaps:80/325 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 IISKIGEYDARDLSHADAQQLF--RGAGNEIRLVVHRDNKIAYTQGATQEAGPGSRSNSTLPPVT 145
            :..::.|.:..||..::..|.:  |.....::.:...:|:|  |:..|   ||        ||..
  Rat   468 LAQEVSETEREDLEESEKTQYWVERLCQTRLQQISSAENEI--TEMTT---GP--------PPPP 519

  Fly   146 PDLMPHRGPSPFLPGPSHFERALQL---PVDTLPQTVFPQLNSSGGYEVPSTVFSPKPTRDHQQD 207
            |.:      ||.:|....|...:.|   .:|.:|..:|        |..|.|. |..|...|...
  Rat   520 PSV------SPLVPPLRRFAGGIHLHTTDLDDIPLDMF--------YYPPKTP-SALPVMPHPPP 569

  Fly   208 VDEEQAAIVNQPYRT-TPLVLPGAKVKKDAPTTES--YLRHYPNPAVRAHPGHDYHDSIMKQRVA 269
                    .|.|.:. .|.|||.:    |..::.|  :::|.|.|.....|.......:...|..
  Rat   570 --------SNPPSKVPAPPVLPSS----DHMSSSSSPWVQHTPPPIPIPPPPSIPTQDLTPTRPL 622

  Fly   270 DTMLHKVVGSEA-DTGRVFHK----QFNSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSP---- 325
            .:.|.:|:|:.. .||...|.    :.|:..|..:::...:......|.....|.:....|    
  Rat   623 PSALEEVLGNHPFRTGDPGHPATDWEANTHSGKPTSSPTPERSFPPAPKTFCPSPQPPRGPGVST 687

  Fly   326 -------------LHRP------LPTKLNGYKKTVQYDPRNSETYRAIQEEGGYSNYGQSSPQEV 371
                         ::||      ||.::  .|:.|.|.....:.:|..:|  |:..|...||:::
  Rat   688 ISKPVMVHQEHNFVYRPAVKSEVLPQEM--LKRMVVYQTAFRQDFRKYEE--GFDPYSMFSPEQI 748

  Fly   372  371
              Rat   749  748

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 5/33 (15%)
DUF4749 285..359 CDD:292558 15/100 (15%)
Ush1cXP_006229284.1 harmonin_N 2..80 CDD:259819
PDZ_signaling 85..165 CDD:238492
PDZ_signaling 209..289 CDD:238492
Cgr1 <316..>358 CDD:281823
PDZ_signaling 751..838 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.