DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and pax6a

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_009296153.1 Gene:pax6a / 30567 ZFINID:ZDB-GENE-990415-200 Length:459 Species:Danio rerio


Alignment Length:137 Identity:29/137 - (21%)
Similarity:48/137 - (35%) Gaps:40/137 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 IAYTQGATQEAGPGSRSN--STLPPVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLPQTVFPQL 183
            :::|.|:.......:.:|  |.|||:                || |..|..||:.       |..
Zfish   347 VSFTSGSMLGRSDTALTNTYSALPPM----------------PS-FTMANNLPMQ-------PSQ 387

  Fly   184 NSSGGYEVPST---------VFSPKPTRDHQQDVDEEQAAIVNQPYRTTPLVLPGAKVKKDAPTT 239
            .||....:|::         .::|...:.|..  .:..||   ....:|.|:.||..|....|.:
Zfish   388 TSSYSCMLPTSPSVNGRSYDTYTPPHMQAHMN--SQSMAA---SGTTSTGLISPGVSVPVQVPGS 447

  Fly   240 ESYLRHY 246
            |..:..|
Zfish   448 EPDMSQY 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492
DUF4749 285..359 CDD:292558
pax6aXP_009296153.1 PAX 31..169 CDD:128645
Homeobox 255..307 CDD:306543
Retinal 341..>459 CDD:330657 29/137 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.