DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and Stxbp4

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_006247190.1 Gene:Stxbp4 / 303443 RGDID:1307903 Length:557 Species:Rattus norvegicus


Alignment Length:259 Identity:60/259 - (23%)
Similarity:99/259 - (38%) Gaps:52/259 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RSSSGLKKRVHF-----ADEQNVGVQV-------------------GSPAH--GELLRGDIISKI 87
            ||||.|::...|     |.|..:|:::                   |...:  |.|..||.:..|
  Rat     9 RSSSPLERDPAFRVITVAKETGLGLKILGGIDRNEGPLVYIHEVTPGGDCYKDGRLKPGDQLVSI 73

  Fly    88 GEYDARDLSHADAQQLFRGAGNEIRLVVHRDNKIAYTQGATQEAGPGSRSNSTLPPVTPDLMPHR 152
            .:.....:|..:|:.:...|    :|......:||:.:..:....||:....: |||:.|..|..
  Rat    74 NKESMIGVSFEEAKNILTRA----KLRWESPLEIAFIRQKSYCGHPGNICCQS-PPVSEDCEPQT 133

  Fly   153 G-----PSP---FLPGPSHFERALQ--LPVDTLPQTVFPQLNSSGGYEVPSTVFSPKPTRDHQQD 207
            .     .||   .||..|...|...  ||..|:.||. |:.:.:|...|||  .:.:||.....|
  Rat   134 SAFNLLSSPAGTLLPKTSSTPRTQDSILPSCTVIQTQ-PEHSQAGLAPVPS--LNNRPTDTSNAD 195

  Fly   208 VDEEQAAIVNQPYRTTPLVLPGAKVKKDAPTTESYLRHYPNPAVRAHPGHDYHDSIMKQRVADT 271
            :........:.|.....| .|.|::|  |...|..|.:     :...|..:.|:::.:|..||:
  Rat   196 IAPAWTDDASGPQGKISL-NPSARLK--AEKLEMALNY-----LGIQPTKEQHEALRQQVQADS 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 10/67 (15%)
DUF4749 285..359 CDD:292558
Stxbp4XP_006247190.1 PDZ_signaling 21..94 CDD:238492 12/76 (16%)
TPR_MLP1_2 299..400 CDD:285204
GBP_C <306..389 CDD:303769
coiled coil 359..369 CDD:293879
coiled coil 378..389 CDD:293879
WW 502..531 CDD:278809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.