DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and Pdzd11

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_038955522.1 Gene:Pdzd11 / 302422 RGDID:1560007 Length:145 Species:Rattus norvegicus


Alignment Length:104 Identity:23/104 - (22%)
Similarity:36/104 - (34%) Gaps:35/104 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VPGYELPTSYRP---------------QPTP------KPPLVPLPSPCRRRSSSGL----KKRVH 59
            :|.||.|.::.|               |..|      |||...|....|...:|.|    .|.:.
  Rat    15 LPAYENPPAWIPPHERVYHPDYNNELTQFLPRIVTLKKPPGAQLGFNIRGGKASQLGIFISKVIP 79

  Fly    60 FADEQNVGVQVGSPAHGELLRGDIISKIGEYDARDLSHA 98
            .:|....|:|          .||.:..:.:.|.:|:.|:
  Rat    80 DSDAHRAGLQ----------EGDQVLAVNDVDFQDIEHS 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 6/31 (19%)
DUF4749 285..359 CDD:292558
Pdzd11XP_038955522.1 PDZ_signaling 45..130 CDD:238492 17/74 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.