DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and PRICKLE4

DIOPT Version :10

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_037529.3 Gene:PRICKLE4 / 29964 HGNCID:16805 Length:384 Species:Homo sapiens


Alignment Length:116 Identity:28/116 - (24%)
Similarity:43/116 - (37%) Gaps:35/116 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 QEAGPGSRSNST---LPPVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLP-----QTVFPQLNS 185
            |:.||.:.|:|.   ||...|:....:||:....|      :|.|..:..|     ||:..||  
Human    18 QDPGPPANSDSDSGHLPGEDPEDTHAQGPAVLSLG------SLCLDTNQAPNWTGLQTLLQQL-- 74

  Fly   186 SGGYEVPSTVFSPKPTRDHQQDVDEEQAAIVNQPYRTTPLVLPGAKVKKDA 236
                              ..||:||.....:.:..| ..|.|..|:.|::|
Human    75 ------------------PPQDIDERYCLALGEEER-AELQLFCARRKQEA 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_canonical <68..117 CDD:483948
DUF4749 285..374 CDD:464948
PRICKLE4NP_037529.3 PET_OEBT 1..116 CDD:193603 28/116 (24%)
LIM1_Testin_like 124..181 CDD:188726
LIM2_Testin_like 187..242 CDD:188727
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.