DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and Pdzd7

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001099832.2 Gene:Pdzd7 / 293996 RGDID:1309882 Length:1031 Species:Rattus norvegicus


Alignment Length:263 Identity:58/263 - (22%)
Similarity:93/263 - (35%) Gaps:93/263 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SPCRRRSSSGLKKRVHF---------------ADEQNVGVQVGSPAHGELLRGDIISKIGE---- 89
            :|....|..|:::.||.               ..|..:|:.|....||.|...:.| |:|:    
  Rat   197 TPSDSSSEDGVRRIVHLYTTSDDFCLGFNIRGGKEFGLGIYVSKVDHGGLAEENGI-KVGDQVLA 260

  Fly    90 -----YDARDLSHADAQQLFRGAGNEIRLVVHRDNKI-AY-------------TQGATQEAGPGS 135
                 :|  |:||:.|.::.:|. ..|.|.:....:. ||             :.|..|:..|.|
  Rat   261 ANGVRFD--DISHSQAVEVLKGQ-THIMLTIKETGRYPAYKEMVSEYCWLDRLSNGVLQQLSPAS 322

  Fly   136 RSNSTL------PPVTPDLMPH------RGP-SPFLPGPSHFERALQLPVDTLPQTVFPQLNSSG 187
            .|:|::      .|.:...:|.      .|| .|...||. :.||     ||..||. |.:   |
  Rat   323 ESSSSVSSYASSAPCSSGSLPSDRMDVCLGPEDPTSQGPG-WGRA-----DTAMQTE-PDM---G 377

  Fly   188 GYEVPSTVFSPKPTRDHQQDVDEEQAAIVNQPYRTTPLVLPGAKVKKDAPTT----ESYLRHYPN 248
            |..| .|..|.:||                       ::|....::.|.|::    :|.|...|.
  Rat   378 GSRV-ETWCSVRPT-----------------------VILRDTAIRSDGPSSTRHLDSALSESPK 418

  Fly   249 PAV 251
            .|:
  Rat   419 TAL 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 15/55 (27%)
DUF4749 285..359 CDD:292558
Pdzd7NP_001099832.2 PDZ_signaling 84..164 CDD:238492
PDZ_signaling 209..289 CDD:238492 19/83 (23%)
HN_PDZD7_like 555..632 CDD:259824
PDZ_signaling 866..954 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.