DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and Pdlim7

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_038951356.1 Gene:Pdlim7 / 286908 RGDID:628769 Length:464 Species:Rattus norvegicus


Alignment Length:246 Identity:54/246 - (21%)
Similarity:85/246 - (34%) Gaps:64/246 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PSPCRRRSSSGLKKRVHFADEQNVGVQV------GSPAHGELLRGDIISKIGEYDARDLSHADAQ 101
            |:|...|...|        .:.||.:.:      |..|...:..||.:..|...:|..|:|.:||
  Rat    11 PAPWGFRLQGG--------KDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGSLTHIEAQ 67

  Fly   102 QLFRGAGNEIRLVVHRDNKIAYTQGATQEA------------GPGSRSNST-----LPPVTPDLM 149
            ...|..|..:.|.:.|...   .|...|:|            .|.:..|.|     .||.|...:
  Rat    68 NKIRACGERLSLGLSRAQP---AQSKPQKALTPPADPPRYTFAPSASLNKTARPFGAPPPTDSAL 129

  Fly   150 PHRGPSP---------FLPGPSHFERALQLPVDTLPQTVFPQLNSSGGYEVPSTVFSPKPTRDHQ 205
            ...|..|         .:|..|. :|.::...|..|:   |....|..:.:.:.:..    .:..
  Rat   130 SQNGCRPLTSQQLLRQLVPDASK-QRLMENTEDWRPR---PGTGQSRSFRILAHLTG----TEFM 186

  Fly   206 QDVDEEQAAIVNQPYRT-TPLVLPGAKVKKDA---PTTESYLRHYPNPAVR 252
            ||.|||.....:|..|| .|  .|.:.:.:::   |||       |:|..|
  Rat   187 QDPDEEFMKKSSQVPRTEAP--APASTIPQESWPGPTT-------PSPTSR 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 13/52 (25%)
DUF4749 285..359 CDD:292558
Pdlim7XP_038951356.1 PDZ_signaling 5..79 CDD:238492 18/75 (24%)
PHA03247 <11..261 CDD:223021 54/246 (22%)
DUF4749 <163..192 CDD:406377 6/35 (17%)
LIM1_Enigma 289..340 CDD:188836
LIM2_Enigma 348..399 CDD:188840
LIM3_Enigma 407..461 CDD:188842
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5207
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.150

Return to query results.
Submit another query.