DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and Slc9a3r1

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_036160.1 Gene:Slc9a3r1 / 26941 MGIID:1349482 Length:355 Species:Mus musculus


Alignment Length:300 Identity:62/300 - (20%)
Similarity:101/300 - (33%) Gaps:88/300 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PLPS-PCRRRSSSGLKKRVHFADEQNVG-----VQVGSPAH-GELLRGDIISKIGEYDARDLSHA 98
            |||. .|..:..:|....:| .::..||     |:.||||. ..||.||.:.::...:....:|.
Mouse    10 PLPRLCCLEKGPNGYGFHLH-GEKGKVGQFIRLVEPGSPAEKSGLLAGDRLVEVNGENVEKETHQ 73

  Fly    99 DAQQLFRGAGNEIRLVV---HRDNKIAYTQGATQE--AGPGSRSNSTLPPVTPD----------- 147
            ......|.|.|.:||:|   ..|.::.....:.:|  ..|..:|....||...|           
Mouse    74 QVVSRIRAALNAVRLLVVDPETDERLKKLGVSIREELLRPQEKSEQAEPPAAADTHEAGDQNEAE 138

  Fly   148 ------LMPH-----RGPSPF-------LPGPSHFERAL--QLPVDT---LPQTVFPQLN----- 184
                  |.|.     :||:.:       ...|..|.||:  ..|.:.   ..|....::|     
Mouse   139 KSHLRELRPRLCTMKKGPNGYGFNLHSDKSKPGQFIRAVDPDSPAEASGLRAQDRIVEVNGVCME 203

  Fly   185 -----------SSGGYEVPSTVFSPKPTRDHQQDVDE---EQAAIVNQPYRTTPLVLP--GAKVK 233
                       ..||.|....|.        .::.||   :...|.:|.:...||..|  ..:::
Mouse   204 GKQHGDVVSAIKGGGDEAKLLVV--------DKETDEFFKKCKVIPSQEHLDGPLPEPFSNGEIQ 260

  Fly   234 KDA-------PTTESYLRHYPNPAVRAHPGHDYHDSIMKQ 266
            |::       |.:||     |.||:......|..:.:..|
Mouse   261 KESSREALVEPASES-----PRPALARSASSDTSEELNSQ 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 15/47 (32%)
DUF4749 285..359 CDD:292558
Slc9a3r1NP_036160.1 PDZ_signaling 12..91 CDD:238492 21/79 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..146 5/35 (14%)
PDZ_signaling 147..226 CDD:238492 13/78 (17%)
EBP50_C 230..355 CDD:286142 15/70 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..355 11/56 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.