DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and pxl1

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_596112.1 Gene:pxl1 / 2540856 PomBaseID:SPBC4F6.12 Length:438 Species:Schizosaccharomyces pombe


Alignment Length:271 Identity:51/271 - (18%)
Similarity:88/271 - (32%) Gaps:89/271 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PTPKPPLVPLPSPCRRRSSSGLKKRVHF--ADEQNVGVQVGSPAHGELLRGDIISKIGEYDARDL 95
            |.|:|.|....||..:|:.:..:.||.|  .|::.....|.||                      
pombe    56 PLPQPSLKTPESPLSKRNPTIKQNRVRFDLPDDELSRSNVSSP---------------------- 98

  Fly    96 SHADAQQLFRGAGNEIRLVVHRDNKIAYTQGATQEAGPGSRSNSTLPPVTPDLMPHRGPSPFLPG 160
                                   .|...|          |.|.||...:..:|:|.      ||.
pombe    99 -----------------------EKTLLT----------SASTSTFDSLKKELLPE------LPS 124

  Fly   161 PSHFERALQLPVDTLPQTVFPQLNSSGGYEVPSTVF----SPKPTRDHQQDVDEEQAAIVNQPYR 221
            .::.:.      |..|.:. .:|||...|.....|:    ..:|..|| ..:::.|....::...
pombe   125 LAYSDD------DEFPSSP-EELNSHVNYPDVRNVYDCHTGLQPLVDH-DCIEDRQKTFASKQLP 181

  Fly   222 TTPLVLPGAKVKKDAPTTESYLRH-------YPNPAVRAH-PGHDYHDSIMKQRVADTMLHKVVG 278
            |.|| ...:|:....|...|:  |       ||.|...:. |.:...:::.:   :|::...:|.
pombe   182 TLPL-QKSSKLSNRRPALHSF--HSAPANSLYPLPTPTSQLPSNLSSNNLFQ---SDSLKPSMVS 240

  Fly   279 SEADTGRVFHK 289
            |...|..|.::
pombe   241 SHTSTKPVLYR 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 3/46 (7%)
DUF4749 285..359 CDD:292558 1/5 (20%)
pxl1NP_596112.1 LIM 258..314 CDD:278823
LIM 318..370 CDD:259829
LIM 378..428 CDD:259829
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.