DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and X11L

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001285376.1 Gene:X11L / 252671 FlyBaseID:FBgn0026313 Length:1170 Species:Drosophila melanogaster


Alignment Length:469 Identity:98/469 - (20%)
Similarity:153/469 - (32%) Gaps:122/469 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RSSASASFSRPAFWKV-----PGYELPT-SYRPQPTPKPPLVPLPSPCRRRSSSGLKKRVHFADE 63
            |.|.|..:.||...::     ||.:..| ...||....|                          
  Fly   100 RDSGSYYYQRPQLHQIRLGRSPGSQFETRDVLPQGLASP-------------------------- 138

  Fly    64 QNVGVQVGSP-----AHGELLRGDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHR---DNK 120
                   |||     |.|:.||...|....:.|...::.|.:.|  |...||..|.|.:   ...
  Fly   139 -------GSPTDVGKADGQCLRDGEIVVFDDIDTNWMNKASSGQ--RPGSNEDVLKVTKMIGQLP 194

  Fly   121 IAYTQGATQEAGPGSRSNSTL---PPVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLPQTVFPQ 182
            ||..:|:.:..|....:|:..   |...|...|.| .||.....::...|.:..|..|...|..:
  Fly   195 IAEYEGSPRRFGSQPNTNTITMGGPRKRPPGFPQR-VSPTTSVANNATAAAKASVGNLIDLVDHE 258

  Fly   183 LNSSGG-----------YEVPST------VFSPKPT-----RDHQQDVDEEQAAIVNQPYRTTPL 225
            ...||.           ||...|      .|...|.     .|:..:..::.|:...|.|..||:
  Fly   259 EERSGTLREKTPTFDYLYEFSETRKVLEEFFKANPEDEKRYTDYTTESGDDVASSQPQEYPATPM 323

  Fly   226 --VLPG---AKVKKD-------APTTESYLRHYPNPAVRAHPGHD-YHDSIMKQR--VADTMLHK 275
              ...|   |::.||       :||.:......|:.|.:.|...: |.||..:..  :|||.|  
  Fly   324 EQAYIGQRLARIPKDELYMVHRSPTKKPPSDQNPSTAYQEHNDIELYIDSNSRSSGDLADTEL-- 386

  Fly   276 VVGSEADTGRVFHKQFNSPIGLYSNNNIEDTIRSTVPFATSESNRLKD-SPLHRPLPTKLNGYKK 339
                ||:..|.......||.....::|..|     :...:::.|...| ..|:..:|...:|...
  Fly   387 ----EANLRRHSRNFTLSPETTDYDSNCGD-----LDSLSNDINCPTDFGKLYTSMPVLEDGLSS 442

  Fly   340 ----------TVQYDPRNSETYRAIQEEGG-----YSNYGQSSPQEVTIPV---QTKVYQPNRLV 386
                      :|..|.:.|...:.:.|..|     .::|...|....|:..   |:.:......:
  Fly   443 GHASDTENNVSVVCDKQQSSQSQPVHEHNGNGERLENDYNVMSASLATLTTDASQSALISDFASL 507

  Fly   387 PGKKPVSAPVSRPP 400
            |  .|.:.|.|.||
  Fly   508 P--MPPAPPPSSPP 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 15/51 (29%)
DUF4749 285..359 CDD:292558 14/84 (17%)
X11LNP_001285376.1 PTB_X11 775..954 CDD:269919
PDZ_signaling 988..1065 CDD:238492
PDZ_signaling 1092..1151 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.