DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and Pdlim4

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001380800.1 Gene:Pdlim4 / 24915 RGDID:3575 Length:335 Species:Rattus norvegicus


Alignment Length:243 Identity:55/243 - (22%)
Similarity:80/243 - (32%) Gaps:81/243 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PSPCRRRSSSGLK-------KRVHFADEQNVGVQVGSPAH-GELLRGDIISKIGEYDARDLSHAD 99
            |||...|...|..       .|||          .||.|. ..|..||:|..|.......::|.:
  Rat    10 PSPWGFRLVGGRDFSAPLTISRVH----------AGSKAALAALCPGDLIQAINGESTELMTHLE 64

  Fly   100 AQQLFRGAGNEIRLVVHR----------DNKIAYTQ---------GATQEAGPGSRSNSTLPPVT 145
            ||...:|..:.:.|.|.|          |:|....:         ...|:..|.:...|::..::
  Rat    65 AQNRIKGCHDHLTLSVSRPENKNWPSSPDDKAQAHRIHIDPEAQASLLQDGSPATSRRSSISGIS 129

  Fly   146 PDLMPHRG--PSPFLPGPSHFERALQLPVDTLPQTVFPQLNSSGGYEVPSTV----FSPKPTRDH 204
              |..:|.  .||:...|       :|||        |...||....:||.:    .||.|:.| 
  Rat   130 --LEDNRSGLGSPYGQPP-------RLPV--------PHNGSSNEVTLPSQMSALHVSPPPSAD- 176

  Fly   205 QQDVDEEQAAIVNQPYRTTPLVLPGAKVKKDAPTTESY--LRHYPNPA 250
                              ||.:||..:..:....:|.|  ||....||
  Rat   177 ------------------TPRILPRNRDCRVDLGSEVYRMLREPAEPA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 13/47 (28%)
DUF4749 285..359 CDD:292558
Pdlim4NP_001380800.1 PDZ_signaling 2..80 CDD:238492 21/79 (27%)
DUF4749 139..235 CDD:406377 25/102 (25%)
LIM_RIL 260..312 CDD:188835
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5207
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.150

Return to query results.
Submit another query.