DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and Grip2

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_006506166.1 Gene:Grip2 / 243547 MGIID:2681173 Length:1049 Species:Mus musculus


Alignment Length:493 Identity:90/493 - (18%)
Similarity:154/493 - (31%) Gaps:154/493 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SRSSASASFSRPAFWKVPGYELPTSYRPQPTPKPPLVPLPSPCRR-------RSSSGLKKR---- 57
            |||.:|..||.|..  .|.:....:   ...|:.|:.|..:..||       |||..|...    
Mouse   395 SRSVSSTPFSSPTM--NPAFPCANA---STLPRGPMSPRTTAGRRRQRRKEHRSSLSLASSTVGP 454

  Fly    58 ----VH------------------------FADEQNVG------VQVGSPAH--GELLRGDIISK 86
                ||                        ||.|....      ::..|||.  |.|..||.:..
Mouse   455 GGQIVHTETTEVVLCGDPLSGFGLQLQGGIFATETLSSPPLVRFIEPDSPAERCGLLQVGDRVLA 519

  Fly    87 IGEYDARDLSHADAQQLFRGAGNEIRLVVHRDNKIAYT-------------------QGATQEAG 132
            |......|.:..:|.||.|.|....::|:..:..:|.:                   .|.|..:.
Mouse   520 INGIATEDGTMEEANQLLRDAALARKVVLEIEFDVAESVIPSSGTFHVKLPKRRGVELGITISSA 584

  Fly   133 PGSRSNSTLPPVTPDL----MPHRGPSPFLPGPSHFERALQLPVDTLPQTVFPQLNSSGGYEVPS 193
            ...|..   |.:..|:    :.|| .....||..      .|.:|.:.....|..::........
Mouse   585 SRKRGE---PLIISDIKKGSVAHR-TGTLEPGDK------LLAIDNIRLDHCPMEDAVQILRQCE 639

  Fly   194 TVFSPKPTRDHQQDVDEEQAAIVN--------------------QPYRTTPLVLPGAKVKKDAPT 238
            .:...|..:|.....::|.:..|:                    :|:  .|:::.|...:..|..
Mouse   640 DLVKLKIRKDEDNSDEQESSGAVSYTVELKRYGGPLGITISGTEEPF--DPIIISGLTKRGLAER 702

  Fly   239 TESYLRHYPNPAVRAHPGHDYHDSI-------MKQRVADTMLHKV-VGSEADTGRVFHKQFNSPI 295
            |.:           .|.|    |.|       :|.|.....:|.: |..|..|.:: .||.:.|:
Mouse   703 TGA-----------IHVG----DRILAINSVSLKGRPLSEAIHLLQVAGETVTLKI-KKQLDRPL 751

  Fly   296 GLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTVQYDPRNSETYRAIQE---- 356
            ....:.::            ||::.:.:.|     |..|.|.....::.|.......|::.    
Mouse   752 LPRQSGSL------------SEASDVDEDP-----PEALKGGLLATRFSPAVPSVDSAVESWGSS 799

  Fly   357 --EGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKPV 392
              :||:...|..:||.....|..:.::|:||.....|:
Mouse   800 ATDGGFGGTGSYTPQVAVRSVTPQEWRPSRLKSSPPPL 837

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 14/48 (29%)
DUF4749 285..359 CDD:292558 11/79 (14%)
Grip2XP_006506166.1 PDZ_signaling 58..140 CDD:238492
PDZ_signaling 160..243 CDD:238492
PDZ_signaling 258..341 CDD:238492
PDZ_signaling 463..551 CDD:238492 18/87 (21%)
PDZ_signaling 564..647 CDD:238492 13/92 (14%)
PDZ_signaling 664..744 CDD:238492 15/97 (15%)
PDZ_signaling 947..1026 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.