DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and GRIP1

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_016874587.1 Gene:GRIP1 / 23426 HGNCID:18708 Length:1188 Species:Homo sapiens


Alignment Length:450 Identity:92/450 - (20%)
Similarity:157/450 - (34%) Gaps:107/450 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VPLPSPCRRRSS-----SGLKKRVHFADEQNVGVQVGSPAH--GELLRGDIISKIGEYDARDLSH 97
            :.:.||..|:..     |.:||              ||.||  |.|..||.:..|......:.|.
Human   661 ITISSPSSRKPGDPLVISDIKK--------------GSVAHRTGTLELGDKLLAIDNIRLDNCSM 711

  Fly    98 ADAQQLFRGAGNEIRLVVHRD----------NKIAYTQGATQEAGP-GSRSNSTLPPVTPDLMP- 150
            .||.|:.:...:.::|.:.:|          ..|.||....:..|| |...:.|..|..|.::. 
Human   712 EDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAIIYTVELKRYGGPLGITISGTEEPFDPIIISS 776

  Fly   151 -------------HRGP------SPFLPGP--SHFERALQLPVDTLPQTVFPQLNSSGGYEVPST 194
                         |.|.      |..|.|.  |.....||:..:|:...:..|.::       .:
Human   777 LTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDA-------QS 834

  Fly   195 VFSPK--PTRDHQQDVD--EEQAAIVNQPYRTTPLVLPGAKVKKDAPTTESYLRHYPNPAVRAH- 254
            ..|||  |...|..|:.  ||.::...:|.:.:.:      .....|:.:|.:..:...|:... 
Human   835 ASSPKKFPISSHLSDLGDVEEDSSPAQKPGKLSDM------YPSTVPSVDSAVDSWDGSAIDTSY 893

  Fly   255 --PGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQFNSPIGLYSNNNIEDTIRSTVP-FATS 316
              .|..:..|.......|....|..||.:...:. ..|....:||    :.||..|||.. ||.:
Human   894 GTQGTSFQASGYNFNTYDWRSPKQRGSLSPVTKP-RSQTYPDVGL----SYEDWDRSTASGFAGA 953

  Fly   317 E------------SNRLKD------SPLHRPL-PTKLNGYKKTVQYD---PRNSETYRAIQEEGG 359
            .            |..|:|      |.:.|.| .|.::|...::.::   ||:....:|..:|..
Human   954 ADSAETEQEENFWSQALEDLETCGQSGILRELEATIMSGSTMSLNHEAPTPRSQLGRQASFQERS 1018

  Fly   360 YS--NYGQSSPQEVTIP--VQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG 415
            .|  :|.|:: :..|:|  |..|.....::....|.:.:|.....:.|....|.::...|
Human  1019 SSRPHYSQTT-RSNTLPSDVGRKSVTLRKMKQEIKEIMSPTPVELHKVTLYKDSDMEDFG 1077

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 14/48 (29%)
DUF4749 285..359 CDD:292558 22/96 (23%)
GRIP1XP_016874587.1 PDZ_signaling 128..208 CDD:238492
PDZ_signaling 227..310 CDD:238492
PDZ_signaling 325..408 CDD:238492
PDZ_signaling 545..633 CDD:238492
PDZ_signaling 646..730 CDD:238492 20/82 (24%)
PDZ_signaling 746..827 CDD:238492 17/80 (21%)
PDZ_signaling 1062..1142 CDD:238492 2/15 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.