DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and Cytip

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_631939.1 Gene:Cytip / 227929 MGIID:2183535 Length:359 Species:Mus musculus


Alignment Length:406 Identity:78/406 - (19%)
Similarity:132/406 - (32%) Gaps:158/406 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTTSRSSASASFSRPAFW---KVP----------GYELPTSYRPQPTPKPPLVPLPSPCRRRSSS 52
            :..:|||:...||    |   ||.          |:|:.| ||.|                    
Mouse    59 LALARSSSLGDFS----WSQRKVVTVEKQDNGTFGFEIQT-YRLQ-------------------- 98

  Fly    53 GLKKRVHFADEQNV----------GVQVGSPAH-GELLRGDIISKIGEYDARDLSHADAQQLFRG 106
                      .||:          .||..|||| ..|..|||.:.:........:|.....|.|.
Mouse    99 ----------NQNICSSEVCTMICKVQEDSPAHCAGLQVGDIFANVNGVSTEGFTHKQVVDLIRS 153

  Fly   107 AGNEIRLVVHRDNKIAYTQGATQEAGPGSRSNSTLPPVTPDLMPHRGPSPFLPGPSHFERA-LQL 170
            :||.:.:                     ...|.|        |.||             || |:.
Mouse   154 SGNLLTI---------------------ETLNGT--------MIHR-------------RAELEA 176

  Fly   171 PVDTLPQTV---FPQLNSSGGYEV----PSTVFSPKPTRDHQQDVDEEQAAIVNQPYRTTPLVLP 228
            .:.||.||:   :.:|.|....|.    ..|..||     :.:::|.:::::.......:|.:|.
Mouse   177 KLQTLKQTLKKKWVELRSLHLQEQRLLHGDTANSP-----NLENMDLDESSLFGNLLGPSPALLD 236

  Fly   229 GAKVKKDAPTTESYLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQFNS 293
            ..::..:: :.:|:|   .:..|.:..|  |..|:               ||......|.:|.::
Mouse   237 RHRLSSES-SCKSWL---SSLTVDSEDG--YRSSM---------------SEDSIRGAFSRQTST 280

  Fly   294 PIGLYSNNNIEDTIRSTVPFATSESNR---LKDSPLHRPLPTKLNGYKKTVQYDPRNSE------ 349
            ....:.:.:.::.:|:    |:|..||   :..|....||..  :.|.......||.|.      
Mouse   281 DDECFHSKDGDEILRN----ASSRRNRSISVTSSGSFSPLWE--SNYSSVFGTLPRKSRRGSVRK 339

  Fly   350 --------TYRAIQEE 357
                    .:||::||
Mouse   340 QILKFIPGLHRAVEEE 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 15/47 (32%)
DUF4749 285..359 CDD:292558 18/90 (20%)
CytipNP_631939.1 PDZ_signaling 76..161 CDD:238492 25/136 (18%)
Interaction with CYTH1. /evidence=ECO:0000250 166..188 11/42 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.