powered by:
Protein Alignment Zasp66 and Shox2
DIOPT Version :9
Sequence 1: | NP_729395.2 |
Gene: | Zasp66 / 38988 |
FlyBaseID: | FBgn0035917 |
Length: | 430 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_038693.1 |
Gene: | Shox2 / 20429 |
MGIID: | 1201673 |
Length: | 331 |
Species: | Mus musculus |
Alignment Length: | 55 |
Identity: | 12/55 - (21%) |
Similarity: | 22/55 - (40%) |
Gaps: | 16/55 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 344 DPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSR 398
:.:.:.|||.:.|.| |:: ...:|..:.||:...|:|..|
Mouse 18 EKKEAITYREVLESG---------------PLR-GAKEPGCVEPGRDDRSSPAVR 56
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R6207 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.