DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and Tamalin

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_620249.1 Gene:Tamalin / 192254 RGDID:70554 Length:394 Species:Rattus norvegicus


Alignment Length:237 Identity:41/237 - (17%)
Similarity:59/237 - (24%) Gaps:127/237 - (53%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VHFADEQNV-------GVQVGSPAH-GELLRGDIISKIGEYDARDLSHADAQQLFRGAGNEIRL- 113
            :|..:||.|       .|...|||. ..|..||.|:.:...:...:.|.:...:.:.:||.:|| 
  Rat   120 LHHREEQRVEMVTFVCRVHESSPAQLAGLTPGDTIASVNGLNVEGIRHREIVDIIKASGNVLRLE 184

  Fly   114 ---------------------------------------VVH----RDNKIAYTQGATQEA---- 131
                                                   :||    :|..|..|..:.:..    
  Rat   185 TLYGTSIRKAELEARLQYLKQTLYEKWGEYRSLMVQEQRLVHGLVVKDPSIYDTLESVRSCLYGA 249

  Fly   132 ---------GP------GSRSNS-----------------------TLPPVTPDLMPHRGPSPFL 158
                     ||      |:|..|                       .|||..|   |.|.|.|  
  Rat   250 GLLPGSLPFGPLLAAPGGARGGSRRAKGDTDDAVYHTCFFGGAEPQALPPPPP---PARAPGP-- 309

  Fly   159 PGPSHFERALQLPVDTLPQTVFPQLNSSGGYEVPSTVFSPKP 200
                                        |..|.|::|..|.|
  Rat   310 ----------------------------GSAETPASVLCPAP 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 13/87 (15%)
DUF4749 285..359 CDD:292558
TamalinNP_620249.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
PDZ_signaling 99..184 CDD:238492 16/63 (25%)
Interaction with PSCD3. /evidence=ECO:0000250 180..257 7/76 (9%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..318 11/57 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.