Sequence 1: | NP_729395.2 | Gene: | Zasp66 / 38988 | FlyBaseID: | FBgn0035917 | Length: | 430 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_620249.1 | Gene: | Tamalin / 192254 | RGDID: | 70554 | Length: | 394 | Species: | Rattus norvegicus |
Alignment Length: | 237 | Identity: | 41/237 - (17%) |
---|---|---|---|
Similarity: | 59/237 - (24%) | Gaps: | 127/237 - (53%) |
- Green bases have known domain annotations that are detailed below.
Fly 58 VHFADEQNV-------GVQVGSPAH-GELLRGDIISKIGEYDARDLSHADAQQLFRGAGNEIRL- 113
Fly 114 ---------------------------------------VVH----RDNKIAYTQGATQEA---- 131
Fly 132 ---------GP------GSRSNS-----------------------TLPPVTPDLMPHRGPSPFL 158
Fly 159 PGPSHFERALQLPVDTLPQTVFPQLNSSGGYEVPSTVFSPKP 200 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Zasp66 | NP_729395.2 | PDZ_signaling | <68..115 | CDD:238492 | 13/87 (15%) |
DUF4749 | 285..359 | CDD:292558 | |||
Tamalin | NP_620249.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..51 | ||
PDZ_signaling | 99..184 | CDD:238492 | 16/63 (25%) | ||
Interaction with PSCD3. /evidence=ECO:0000250 | 180..257 | 7/76 (9%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 293..318 | 11/57 (19%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |