DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and Pitx3

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_006526827.1 Gene:Pitx3 / 18742 MGIID:1100498 Length:388 Species:Mus musculus


Alignment Length:261 Identity:51/261 - (19%)
Similarity:95/261 - (36%) Gaps:75/261 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 LNS----SGGYEVPSTVFSPKPTRDHQQDVDEE-----QAAIVNQPYRTTPLVLPGAKVKKDAPT 238
            |||    ||.|.:|.     .|:.:.:.::..:     :..::.:....:|     |....||.|
Mouse    55 LNSACHCSGCYPLPG-----PPSTEIEDEIKRQRPPSMEFGLLGEAEARSP-----ALSLSDAGT 109

  Fly   239 TESYLRHYPNPAVRAH--PGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQFNSPIGLYSNN 301
                    |:|.:..|  .|.::.||       :.....:.|...:.|.:..||...... :::.
Mouse   110 --------PHPPLPEHGCKGQEHSDS-------EKASASLPGGSPEDGSLKKKQRRQRTH-FTSQ 158

  Fly   302 NIEDTIRSTVPFATSESNRLKDSPLHRPLP--TKLNGYKKTVQYDPRNS---ETYRAIQEE---G 358
            .:::.      .||.:.||..|......:.  |.|...:..|.:..|.:   :..|:.|.|   |
Mouse   159 QLQEL------EATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERSQQAELCKG 217

  Fly   359 GYS-----------------NYGQSSPQEVTIPVQTKVYQP---NRLVPGKKPV-SAPVSRPPYN 402
            |::                 :||...|:.:..|:..|.: |   |.:..|  |: |.||..||.:
Mouse   218 GFAAPLGGLVPPYEEVYPGYSYGNWPPKALAPPLAAKTF-PFAFNSVNVG--PLASQPVFSPPSS 279

  Fly   403 V 403
            :
Mouse   280 I 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492
DUF4749 285..359 CDD:292558 14/81 (17%)
Pitx3XP_006526827.1 Homeobox 152..205 CDD:365835 9/59 (15%)
PTZ00395 <228..>322 CDD:185594 14/56 (25%)
OAR 344..361 CDD:367680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.