DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and Pitx1

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_035227.1 Gene:Pitx1 / 18740 MGIID:107374 Length:315 Species:Mus musculus


Alignment Length:137 Identity:29/137 - (21%)
Similarity:46/137 - (33%) Gaps:40/137 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SASASFSRPAFWKVPGYELPTSYRPQPTPKPPLVPLPSPCRRRSSSGLKKRVHFADEQNVGVQVG 71
            |:.:.||.|:  .:....:|:|..|...|..|            :|||         .|:....|
Mouse   210 SSQSMFSAPS--SISSMTMPSSMGPGAVPGMP------------NSGL---------NNINNLTG 251

  Fly    72 SPAHGELLRGDIISKIGEYDARDLSHADAQQLFRGAGN----EIRLVVHRDNKIAYTQGATQEAG 132
            |..:..:..|..     .|.    :.|....::|...|    .:||...:.:...|  |..|  |
Mouse   252 SSLNSAMSPGAC-----PYG----TPASPYSVYRDTCNSSLASLRLKSKQHSSFGY--GGLQ--G 303

  Fly   133 PGSRSNS 139
            |.|..|:
Mouse   304 PASGLNA 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 9/50 (18%)
DUF4749 285..359 CDD:292558
Pitx1NP_035227.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..104
Homeobox 94..147 CDD:365835
Interaction with PIT-1 151..280 19/101 (19%)
Forkhead_N 196..>275 CDD:369872 18/96 (19%)
OAR 277..294 CDD:367680 3/16 (19%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 281..294 2/12 (17%)
Nuclear localization signal. /evidence=ECO:0000255 287..291 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.