DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and Pax6

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001231127.1 Gene:Pax6 / 18508 MGIID:97490 Length:436 Species:Mus musculus


Alignment Length:455 Identity:87/455 - (19%)
Similarity:149/455 - (32%) Gaps:155/455 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 HFADEQNVGVQVGSPAHGELLRGDIISKIGEYDAR--DLS-----HADAQQLFRGAGNEIRLVVH 116
            |....|..||.|......:..|..|: ::....||  |:|     ||||:            |..
Mouse     5 HSGVNQLGGVFVNGRPLPDSTRQKIV-ELAHSGARPCDISRILQTHADAK------------VQV 56

  Fly   117 RDNK------IAYTQGATQEAGP-------GSRSNSTLPPVTPDLMPHRGPSPFLPGPSHFERAL 168
            .||:      ::...|...|.|.       ||:.....|.|...:..::...|.:......:|.|
Mouse    57 LDNENVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLL 121

  Fly   169 QLPV---DTLPQ------------TVFPQLNSSGGYE------------------VPSTVFSPKP 200
            ...|   |.:|.            :...|:.:.|.|:                  .|.|....:|
Mouse   122 SEGVCTNDNIPSVSSINRVLRNLASEKQQMGADGMYDKLRMLNGQTGSWGTRPGWYPGTSVPGQP 186

  Fly   201 TRD-----------------HQQDVDEEQAAI----VNQPYRTTPLVLPGAKVKKDAPTTESYLR 244
            |:|                 :.:|.||.|..:    ..|..||:     ..:.:.:|...|....
Mouse   187 TQDGCQQQEGGGENTNSISSNGEDSDEAQMRLQLKRKLQRNRTS-----FTQEQIEALEKEFERT 246

  Fly   245 HYPN-------------PAVRAHPGHD-------YHDSIMKQR--VADTMLHKVVGSEADTGRVF 287
            |||:             |..|......       ..:.:..||  .::|..|..:.|...|. |:
Mouse   247 HYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRRQASNTPSHIPISSSFSTS-VY 310

  Fly   288 H--KQFNSPIGLYSNNNI----EDTIRST------VPFATSESNRLKDSPLHRPLPTKLNGY--- 337
            .  .|..:|:..:::.::    :..:.:|      :|..|..:|    .|:..|:|::.:.|   
Mouse   311 QPIPQPTTPVSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANN----LPMQPPVPSQTSSYSCM 371

  Fly   338 ---------KKTVQYDPRNSETYRAIQEEG--GYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP 391
                     :....|.|.:.:|:...|..|  |.::.|..|| .|::|||         |||.:|
Mouse   372 LPTSPSVNGRSYDTYTPPHMQTHMNSQPMGTSGTTSTGLISP-GVSVPVQ---------VPGSEP 426

  Fly   392  391
            Mouse   427  426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 12/53 (23%)
DUF4749 285..359 CDD:292558 16/99 (16%)
Pax6NP_001231127.1 PAX 4..142 CDD:128645 31/149 (21%)
Homeobox 228..281 CDD:395001 9/57 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.