DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and C50F7.3

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_501268.1 Gene:C50F7.3 / 183682 WormBaseID:WBGene00016843 Length:313 Species:Caenorhabditis elegans


Alignment Length:138 Identity:33/138 - (23%)
Similarity:52/138 - (37%) Gaps:46/138 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTM-LHKVVGSEADTGRVFH-----KQFNSPIGLYS- 299
            :.||.|.|:  ..|....|:|..    .||: |:.:       .:|||     |:....|.:.. 
 Worm   104 FKRHIPRPS--GFPPLQKHESYS----TDTLVLYNL-------KKVFHLGLDIKEIEGKIVVCDL 155

  Fly   300 -NNNIED---TIRSTV-------PFA-TSESNRLKDSPLHR-------------PLPTKL-NGYK 338
             .|::.|   ::..|:       |.: |..:.|::.|.|.|             ||...| |...
 Worm   156 VENSLGDMTFSVGETILDVDGEKPLSCTGFNERVRKSLLIRNYCLVTVEIPSTDPLKNLLRNQIT 220

  Fly   339 KTVQYDPR 346
            |||:..||
 Worm   221 KTVKEAPR 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492
DUF4749 285..359 CDD:292558 23/94 (24%)
C50F7.3NP_501268.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.