Sequence 1: | NP_729395.2 | Gene: | Zasp66 / 38988 | FlyBaseID: | FBgn0035917 | Length: | 430 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_505852.3 | Gene: | T19B10.5 / 179553 | WormBaseID: | WBGene00011833 | Length: | 596 | Species: | Caenorhabditis elegans |
Alignment Length: | 226 | Identity: | 50/226 - (22%) |
---|---|---|---|
Similarity: | 79/226 - (34%) | Gaps: | 69/226 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 226 VLPGAKVK-----------KDAPTTESYLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGS 279
Fly 280 EADTGRVFHKQFNSPIGLYSNNNIEDTIRSTVPFATSESN-RLKDSPLHRPLPTKLNGYKKTVQY 343
Fly 344 DPR-----NSETYRAIQEEGGYSNYGQ-------------------SSPQEVTIPVQTKVYQP-- 382
Fly 383 ---------NRLVP-GKKPVS---APVSRPP 400 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Zasp66 | NP_729395.2 | PDZ_signaling | <68..115 | CDD:238492 | |
DUF4749 | 285..359 | CDD:292558 | 16/79 (20%) | ||
T19B10.5 | NP_505852.3 | PDZ | 137..208 | CDD:214570 | 11/51 (22%) |
PTZ00449 | <340..483 | CDD:185628 | 10/36 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |