DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and Mpdz

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001292213.1 Gene:Mpdz / 17475 MGIID:1343489 Length:2069 Species:Mus musculus


Alignment Length:226 Identity:55/226 - (24%)
Similarity:81/226 - (35%) Gaps:54/226 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RSSASASFSRP---AFWKVPGYELPTSY---RPQPTPKPPLVPLPSPCRRRSSSGLKKRVHFADE 63
            :::|.:|:|:|   ..|:.|...|..|.   |...:              |.|:|...|..|...
Mouse  1141 QNAAYSSWSQPRRVELWREPSKSLGISIVGGRGMGS--------------RLSNGEVMRGIFIKH 1191

  Fly    64 QNVGVQVGSPA--HGELLRGDIISKIGEYDARDLSHADAQQLFRGAGNE----IRLVVHRDNKIA 122
                |...|||  :|.|..||.|.::...|.||.||..|.:..|.|||.    ::.:::|..|  
Mouse  1192 ----VLEDSPAGKNGTLKPGDRIIEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRK-- 1250

  Fly   123 YTQGATQEAGPGSRSNSTLPPVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLPQTVFPQLNSSG 187
                            |.||.:...|.|....|...|    |..:|||..|..|.....:.....
Mouse  1251 ----------------SPLPSLPHSLYPKYSFSSTNP----FADSLQLTTDQAPSQSESETEKPA 1295

  Fly   188 GYEVPSTVFSPKPTRDHQQDVDEEQAAIVNQ 218
            ...||.:  ||....:...|..:..|..|::
Mouse  1296 LCNVPPS--SPSVFSEMGSDCAQPSATAVSE 1324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 19/52 (37%)
DUF4749 285..359 CDD:292558
MpdzNP_001292213.1 L27_2 6..63 CDD:117611
PDZ_signaling 140..222 CDD:238492
PDZ_signaling 256..335 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..372
PDZ 375..464 CDD:214570
PDZ_signaling 553..622 CDD:238492
PDZ_signaling 694..777 CDD:238492
PDZ_signaling 994..1064 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1125..1144 0/2 (0%)
PDZ_signaling 1151..1242 CDD:238492 30/108 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1278..1313 7/36 (19%)
PDZ 1349..1434 CDD:214570
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1449..1473
PDZ_signaling 1483..1563 CDD:238492
MPDZ_u10 1564..1625 CDD:293272
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1571..1611
PDZ 1626..1710 CDD:214570
PDZ_signaling 1722..1802 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1809..1848
PDZ_signaling 1859..1944 CDD:238492
PDZ_signaling 1985..2068 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.